SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000018841 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000018841
Domain Number 1 Region: 1402-1540
Classification Level Classification E-value
Superfamily PH domain-like 2.05e-49
Family Phosphotyrosine-binding domain (PTB) 0.00000143
Further Details:      
 
Domain Number 2 Region: 180-307
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.34e-39
Family PLC-like (P variant) 0.0025
Further Details:      
 
Domain Number 3 Region: 13-177
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.81e-30
Family Dual specificity phosphatase-like 0.00019
Further Details:      
 
Domain Number 4 Region: 1248-1389
Classification Level Classification E-value
Superfamily SH2 domain 3.9e-22
Family SH2 domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000018841   Gene: ENSGACG00000014268   Transcript: ENSGACT00000018879
Sequence length 1547
Comment pep:known_by_projection group:BROADS1:groupI:21543442:21565537:1 gene:ENSGACG00000014268 transcript:ENSGACT00000018879 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RNQSVAMEESHEVDLVYITERIISVCFPAGAEERSYTTNLKEVATMLRSKHGEHYLILNL
SEWRSDLSTLNPKVVEFGWPDNHAPALDKICSMCKAIDTWLNGDPRNVVVLHNKGNRGRT
GVAVAAYMHYSNISASADQALDRFSMRRFYEDKALPAAQPSQIRYVRYFNGLLSGHIKIN
NKPLFLHHVIMHGIPNFESKGGCRPFLKIYQAMQPVYTSGIYNVQGDSSTSICITIEPGL
LLKGDILLKCYHKRYRNSTRDVMFRVQFHTCAIHDLGVVFGKSELDDTFKDERFPEYGKV
EFVFSYAPEKIKGLGHLENGPSVSVDYNTQDPLIRWDSYESFSQRCEDTADGDVVHTQGP
LDGSLYARVRKKDSLDHPLQTTDRTLPVTGHASLPAVDHTLSVSSDSGNSTASVKTDRTD
EHSQSVHGAVNHNNPTAAHPALSPQEKRELHQLLSGLEAQTHQRQAYLSTSTSPGGGIRH
LVPAQVHVNGGHTRLVAAPSSEERETEILDDELPNSQEGNSVDSLGTLSSLEGQATPADL
YYQSQTATSRQNDGPYLERVVVGEKLSEMPVHGVQTPTALQDRSVDSASPQGGYNNYQNG
GGIYHTQSFGNPPDGSPEANPKLMPRAPERSTSSREAVQRGLNTWHQYSLPDDPFGPPLQ
STHSLPHFPTSASQRDIEQSIEALNMLMLDLDPINSHMSKSHSAPPGEDSLSLSQAPFSQ
TLARPSYQADSAIHCYNNTGSVSNSFHQPLWSTGRPVHNQSPLMESPGYSPQRSNEGYQH
QNITPTQTPEPFLHTRQAAHHHPTDASPTFNQQVAVKPPKETSSSSLPREQEAEEQKLNL
EGLVAHRIAGVRSRGMTPEVTQETGRRRTTSEGQYQSSHDNTAMADSSDFAHNLALNPGG
QPREGLMHSYREAFEDDEADGAPALPPKSSSPSPRLLCSTIPLSVGPALPLVDVDVLGKR
CGQVMSWGDSSFLITSQRYTTKIPQKKISGKTRSLWSERKAVRICSVARDFISPSSLSRP
PEVVFNSLTSITSLFSPAARSPPGWTKTPLSALGLKSHHLGASDNRSFGDFRAQPFNTLS
SSSPVHSADGPASPEGSQVNIMGVHTVPGSPNTLHRTVATNTPPSPALQRRLGQASPSLG
RMPPPAGVPSSPLIGRNAKTAAGGVPPSPLMGRRMAASGHSTPDELGAASRQGSAQPPST
PAFPVSPQLPEKRHMSSGDAERTDIKNPTPASGVSAPNLSGTQTLPEASKSIYADGYPDI
KMNVKFVQDTSKFWYKPDITREQAINVLKDREPGAFVIRDSHSFRGAYGLAMKVACPPPT
LQQNKKVGDMTNELVRHFLIETSPKGVRLKGCPNEPYFGCLSALVYQHSMTPLALPCKLM
IPAKDPNEEALELVTPTDAVVELLKQGAACNVLYINSVDMESLTGPQAIAKAISQTLATN
PLPVATTVHFKVSTQGITLTDSQRKLFFRRHYPINTVTYCDTDPQDRKWGKEGGGSVSAR
LFGFVARKQGSTTDNVSHLFAELDPDQPASAIVSFASKMNLSSGKKL
Download sequence
Identical sequences G3PML0
ENSGACP00000018841 69293.ENSGACP00000018841 ENSGACP00000018841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]