SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000018868 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000018868
Domain Number 1 Region: 618-752
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.79e-28
Family Synaptotagmin-like (S variant) 0.056
Further Details:      
 
Domain Number 2 Region: 4-145
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.19e-26
Family PLC-like (P variant) 0.00000371
Further Details:      
 
Domain Number 3 Region: 1455-1571
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.49e-17
Family Synaptotagmin-like (S variant) 0.015
Further Details:      
 
Domain Number 4 Region: 477-538
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000673
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000018868   Gene: ENSGACG00000014286   Transcript: ENSGACT00000018906
Sequence length 1606
Comment pep:known_by_projection group:BROADS1:groupXIII:18598461:18683779:-1 gene:ENSGACG00000014286 transcript:ENSGACT00000018906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFSLCLPVKKAKLHGPPDKFNAYVTLKVQNVKSTTVTVRGDQPCWEQDFMFEINHLESGL
VVELWNKGLIWDTMIGTALIPLDSIGQSDEEGPGHWTSLDSEVLMREDEICGTSNPTPHQ
VLLDTRFELPFDIPEDEAQYWSGKLDRINTMRIHDEYPLQEEVRRGRMASVPSQCCSWSY
FGWNDQQTLDDHDSAVDDRDSDYRSETGSRPPRFHNTPQTNSSVHQYPVGRRAQHPTPSG
EADSIRSYELDYREIRRPSRQSKKAHLLEAMNPSKSLKTNPLGLERAQKQNDSHQETKTS
YSAHESIDLSNRGESPERQNPLLVTYLDAEEEAGEQQVEKEQNAPPEPGSNKDLKDSLVI
SPQPTETKVCFFEDGPPPCSPSKVRWLKAYNKVRVRLLESRDQGGDPSKHPWAKPGRGNT
PFGIDSMPDLRKRRPIPLVSELSMIQTRKAGLAHTLSTRTSLKDEELKNHVYKKTLQSLI
YPISCTTPHNFEVWTATTPTYCHECEGLLWGIARQGMRCAECGVKVHEKCQELLNADCLQ
RAAEKSSKTGAEDRTQHIIMAMKDRMKIRERNKPEIFEEIRKVFNAPRVIHVQHMKTVKQ
SVLDGTSKWSAKIAINAVVSAQGLQAKDRTGSSDPYVTIQVGKTKKRTKTIYGNLNPVWE
EKFSFECHNSSDRIKLRVWDEDDDIKSRVKQRLKRESDDFLGQSIIEVRTLSGEMDVWYN
LDVVDKSAVSGAIRLQISVEIEGEEKVAPYHVQYTCLHENMFHFSTDVEGGGVVKIPAAH
GDDAWKVYYDEVKQDIVDEFAMRYGIESIYQAMTHFSCLSSKYMLSGVPAVMSTLLANIN
AFYAHPTASTNVSAPARFAASNFGRDRFVKLLDQLHNSLRIDLSMYRNNFPASSKPRLHD
LKSTVDLLTSITFFRMKVWELQSPPRAAHVVDCFKPRLTSPYEFFNTCLELFNRQFPTRR
STEQEEQGPSIQNLDFWPKLITLMVSIIEEDKNSYTPIINQFPQELDVGKVSTEVMWRLF
AQDMKYALTEHEKHKLCKTADYMNLHFKVKWLYNEYVKDLPTFTDAVPEYPAWFLPFVLA
WLAENEDVSMEFMHGALERDKREGFQQTSEHALFSSSVVDIFTQLNQSFEIIKKLDCPDP
AVVAQYNRRFAKIFNLHLTLFLCSLSLSFKTESKKEKLPCMFRRNRAQLPRLRTRRFAAS
HVRELDTEAADILNELQVKLNTHLDNFSIVFAKSFQARINSCMRQMAEILYQIKGPPNHS
TAEADADNMLRPLMEFLDGNLSIFADICEKTVLKRILKDLWKTVLSSLEKSIVLPQSNDS
LGAQLLTAAKGLSNLKSLQGGGEAKTLTPKQCIIIDAGLETIKQYFHAGGNGLKKTFVEK
SPELASLRYALSLYSQSTDALIKTFVTTQHSQVHDGMGIRITGSEKIRPDRGPGVEKPIG
EAVLQIDMMLGKERKVSVRVIAVNDMKWQTSGMFRPFVDVSMVGPFLADKKRKFTTKSKN
NSWSAKFNEAFQFVLGKESPDCYELQVTVKDYCFGRADRVVGVAVLQLRDVADRKSCVCW
CPLGPRVHTDETGLTVMRILSQRPADEVAKEVVRLKAETRPAEEGR
Download sequence
Identical sequences G3PMN7
ENSGACP00000018868 ENSGACP00000018868 69293.ENSGACP00000018868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]