SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000018908 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000018908
Domain Number 1 Region: 289-577
Classification Level Classification E-value
Superfamily BEACH domain 1.7e-125
Family BEACH domain 0.0000000185
Further Details:      
 
Domain Number 2 Region: 135-257
Classification Level Classification E-value
Superfamily PH domain-like 4.79e-23
Family PreBEACH PH-like domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000018908   Gene: ENSGACG00000014318   Transcript: ENSGACT00000018946
Sequence length 635
Comment pep:known_by_projection group:BROADS1:groupXIII:18839790:18846422:1 gene:ENSGACG00000014318 transcript:ENSGACT00000018946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRNDMFYIHYPYIPEMEPNTNSAQKPLRYRRAISYDSKEYFVRLLSGNPGMYQHSVEHS
TEGETTRHEPEHGEDTIARVKGLVKAPLKRSRSTADGADEDSQEQLQEQLLESGGPEEEQ
RTDNTSLLRLLEEGEKIQHMYRCARVQGLDTSEGLLLFGKEHFYVIDGYTMTVSREIRDI
DTLPPNLHEAIIPRGARQGQSQLKRTCSIFAYEDIKEVHKRRYLLQPMAVEVFSADGRNY
LLAFQKGVRNKVYQRFLAVVPSLADSSESVSGQRPNTSVEQGSGLLSTLVGEKSVTQRWE
RGEISNFQYLMHLNTLAGRSYNDLMQYPVFPWILADFDSEELDLNNPKTFRNLAKPMGAQ
TDDRLTQYKKRYKDWEDPTGETPAYHYGTHYSSAMIVASYLVRMEPFTQIFLRLQGGHFD
LADRMFHSVREAWLSASKHNMADVKELIPEFFYLPEFLLNANNFDLGAKQNGTKLGDCIL
PPWAKGDPREFIRVHRDALECDYVSAHLHEWIDLIFGYKQQGPPAVESVNVFHHLFYEGQ
VDIYNINDPLKETATIGFINNFGQIPKQLFKKPHPPKRVRGKANGDVASVPPSSNGDKIF
FHHLDNLRPSLAPVKELKEPVGQIMCTDKGILAVE
Download sequence
Identical sequences G3PMS5
ENSGACP00000018908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]