SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000018935 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000018935
Domain Number 1 Region: 477-535
Classification Level Classification E-value
Superfamily UBA-like 8.67e-16
Family CUE domain 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000018935   Gene: ENSGACG00000014350   Transcript: ENSGACT00000018973
Sequence length 766
Comment pep:known_by_projection group:BROADS1:groupXIII:18889876:18895161:1 gene:ENSGACG00000014350 transcript:ENSGACT00000018973 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACALVPLDELQVTEPGPAGKAHALPALHPDRKEERCFLPYRSPPESGSPAEVEEFLEHA
KFITEDLEWLLALPHDKFWCQVVFDESLQRCLDSYLHHAPRGLDLAAAASSPAVVDTQRA
VHRAVFLAFLRMATHKESKENFITPAVFGEIIYENFLFDIPKILDLCVLFGKGNSQLLHK
MIDNIFTQQPSYYIDLDETVPTVLQVFDTILDKCGLYCEGATAMEPMKLNSHKQPTAMTM
SQQDLADLVLYLCDSTTTIHAFLDIFPAGCSSFHSHGFLGRLTSFYETAVPDLEKALRKR
NFDDKRVQEDLWRRLSHSCREIVEMAHLLLHHTCLQPILEGGENMQTFAEELLLLFTSFL
PEKRFLSDYDEQFPIADDISLLQQALPVLDETRTSYLLQGVQSAWDSVGRRSRPASASSP
GFELQEARQPEGAEAMLAPRKGNDVSSVTVSKSSHINKDIYGKKKEQKGAGCAVSEAELE
SLLSCIRDLLPDLGEGFLLACLQEYNYSSELVINNILEDRLTPGLDQMDRAAPRPVKEEL
PDVLDVRSNVFDDDEFDVFRRDQVDMSRIWKGRRKGENAREMLNDKQHVAEQKARYLTYE
TVVDEVVVEPGESGEAYDLNYDDEYDDTYDVSQVGANDLDGDSLLSRRPFTVPQILRKVN
KPEFEEEGEDEEEEETPQNNVNRDQFVQDPALLRERAEARRAAMHQRKGFRPEPRPSSVV
GQPKGQGQKLETVLDRRKKEAAKGRGANHNRRNMADRKRNKGMIPS
Download sequence
Identical sequences G3PMV2
ENSGACP00000018935 ENSGACP00000018935 69293.ENSGACP00000018935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]