SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000018960 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000018960
Domain Number 1 Region: 16-145
Classification Level Classification E-value
Superfamily PH domain-like 2.61e-22
Family Pleckstrin-homology domain (PH domain) 0.00024
Further Details:      
 
Domain Number 2 Region: 146-260
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000000196
Family SH2 domain 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000018960   Gene: ENSGACG00000014374   Transcript: ENSGACT00000018998
Sequence length 349
Comment pep:known_by_projection group:BROADS1:groupVIII:18952604:18960238:1 gene:ENSGACG00000014374 transcript:ENSGACT00000018998 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLTMMMVKLTARQRSQLPTCYYEGYLTKRSFKDKTSRKLWTCLCGNTLFFFNEKRNTEYI
EKVDLRGFVSITDDSSQDRNLDAARFNLQLKEENIRFTALNLEARELWKGYIRSVVELAV
PASINLLPGQIQTLKETVEKEEARINNASPPVVTNNAAPVSLQGDKPACYHNVTRLEAEL
LLEREAVRGNMLLRPGSAGSSFAVTTRQHLEGSIIRHYRVTPKHTGGFLIDVDNPVLCAT
LHDVIHYLVEKSDGVLTPLIFEETYEKNISFISKDCENGESSLQQALTSLGPPSAPPKKV
GFEKKAPKKAIMPPVPAPRRLLPSPSSTNGDQKMRVVTEPQGQSTSSSL
Download sequence
Identical sequences G3PMX7
ENSGACP00000018960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]