SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000019028 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000019028
Domain Number 1 Region: 5-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000122
Family Ubiquitin-related 0.025
Further Details:      
 
Domain Number 2 Region: 604-631
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000000251
Family Ran binding protein zinc finger-like 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000019028   Gene: ENSGACG00000014425   Transcript: ENSGACT00000019066
Sequence length 632
Comment pep:known_by_projection scaffold:BROADS1:scaffold_112:191172:198035:-1 gene:ENSGACG00000014425 transcript:ENSGACT00000019066 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADVIVVRVQSPDGMKKIASTKRETAAALLKKVAKEFGFNTNGFSIYLNRNKTGEILSQN
KTLSLLKIKHGDMLYLFPSASSSSSGEVMDTATPHSSSSQPSVSSSSSSSSFSSSSSSMI
PRSFSAPQVQEDEIDQYLTKQDGKIYRNKDPQLCHHGSLGKCVHCVPLEPFDEDYLNHLD
PPVKHMSFHAYLRKLTGGADKGKFAALENISCKIKSGCEGHLPWPEGICTKCQPSAITLN
RQKYRHVDNIMFENHTIADRFLDFWRKTGSQRMGYLYGRYTEHKDIPLGIRAEVAAIYEP
PQNATQNSLELVDDPKAAAVDEIAAKLGLCKVGWIFTDLLSEDTRIGTVRFTRNHDSHYL
SAEECITAGYFQNLHSNPCRLSRDGHFGSKFVTVVATGGPDNQVHFEGYQVSNQCMALVR
DECLLPCRDAPELGFAKESCSEQYVPDVFFKDKDKFGNDVTFLARPLPVEYLIIDITTTF
PKDPQYTFCSTQRFPIENRDILGETQDFHTLATYLSQCTSTAFLDIVSDFHLLLFLVTNE
VMPLRDSIGLLLDAVRSSNEDLAQTWKKSEQWATIEQLCSTVGGQPSSSQGYGATGGPSV
PASSSAMWSCLHCTFMNQPGTELCEMCSLPRS
Download sequence
Identical sequences G3PN45
ENSGACP00000019028 ENSGACP00000019028 69293.ENSGACP00000019028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]