SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000019031 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000019031
Domain Number 1 Region: 5-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000117
Family Ubiquitin-related 0.025
Further Details:      
 
Domain Number 2 Region: 593-620
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000000235
Family Ran binding protein zinc finger-like 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000019031   Gene: ENSGACG00000014425   Transcript: ENSGACT00000019069
Sequence length 621
Comment pep:known_by_projection scaffold:BROADS1:scaffold_112:191197:198064:-1 gene:ENSGACG00000014425 transcript:ENSGACT00000019069 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADVIVVRVQSPDGMKKIASTKRETAAALLKKVAKEFGFNTNGFSIYLNRNKTGEILSQN
KTLSLLKIKHGDMLYLFPSASSSSSGEVMDTATPHSSSSQPSVSSSMIPRSFSAPQVQED
EIDQYLTKQDGKIYRNKDPQLCHHGSLGKCVHCVPLEPFDEDYLNHLDPPVKHMSFHAYL
RKLTGGADKGKFAALENISCKIKSGCEGHLPWPEGICTKCQPSAITLNRQKYRHVDNIMF
ENHTIADRFLDFWRKTGSQRMGYLYGRYTEHKDIPLGIRAEVAAIYEPPQNATQNSLELV
DDPKAAAVDEIAAKLGLCKVGWIFTDLLSEDTRIGTVRFTRNHDSHYLSAEECITAGYFQ
NLHSNPCRLSRDGHFGSKFVTVVATGGPDNQVHFEGYQVSNQCMALVRDECLLPCRDAPE
LGFAKESCSEQYVPDVFFKKDKDKFGNDVTFLARPLPVEYLIIDITTTFPKDPQYTFCST
QRFPIENRDILGETQDFHTLATYLSQCTSTAFLDIVSDFHLLLFLVTNEVMPLRDSIGLL
LDAVRSSNEDLAQTWKKSEQWATIEQLCSTVGGQPSSSQGYGATGGPSVPASSSAMWSCL
HCTFMNQPGTELCEMCSLPRS
Download sequence
Identical sequences G3PN48
ENSGACP00000019031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]