SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000019039 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000019039
Domain Number 1 Region: 3-127
Classification Level Classification E-value
Superfamily PUG domain-like 2.09e-30
Family PUG domain 0.0019
Further Details:      
 
Domain Number 2 Region: 157-262
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.09e-18
Family UBX domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000019039   Gene: ENSGACG00000014431   Transcript: ENSGACT00000019077
Sequence length 295
Comment pep:known_by_projection group:BROADS1:groupVIII:19018011:19024558:-1 gene:ENSGACG00000014431 transcript:ENSGACT00000019077 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFEEDAVEASVMMVHTFNKDREKVKAAVDIMSKYIENICKNPTEEKYRKIKLSNKVYQE
KVRCVDGCREFLEALGFTSILLPVEGQEEEEEFLVLLEHGPDALELMKERRDRLQRGEPV
RAQLDRQPQAFRSSPHGQRFELPPDFYNLTAEELKREQQQRSESVEKNAMMRTKAMREKE
EQRERRKYNYTLLRIRLPDGSLLQGTFYAWDRLTTLFCFVRDSLVDGWRPFELLAPGGQK
LTESEEVALAECNLVPAALLTFSWDAAVQADITAAGGSSSAILKPELLETLWTLS
Download sequence
Identical sequences G3PN56
ENSGACP00000019039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]