SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000019045 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000019045
Domain Number 1 Region: 142-269
Classification Level Classification E-value
Superfamily PUG domain-like 1.44e-30
Family PUG domain 0.0019
Further Details:      
 
Domain Number 2 Region: 299-404
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.65e-18
Family UBX domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000019045   Gene: ENSGACG00000014431   Transcript: ENSGACT00000019083
Sequence length 437
Comment pep:known_by_projection group:BROADS1:groupVIII:19018698:19024551:-1 gene:ENSGACG00000014431 transcript:ENSGACT00000019083 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKFFEDIKKDIKFKSAGPGKKLTEASSSKAEVVQSSCGSKHNRNAPSEGSQRAGAAALA
RIEQHPRPKVHTSQDAIRNQVKRELETAALADKERSNPEEESKVVEKDLSCLSVSGVYFT
CPLTGATLTKSEREVHIKEAILMRFEEDAVEASVMMVHTFNKDREKVKAAVDIMSKYIEN
ICKNPTEEKYRKIKLSNKVYQEKVRCVDGCREFLEALGFTSILLPVEGQEEEEEFLVLLE
HGPDALELMKERRDRLQRGEPVRAQLDRQPQAFRSSPHGQRFELPPDFYNLTAEELKREQ
QQRSESVEKNAMMRTKAMREKEEQRERRKYNYTLLRIRLPDGSLLQGTFYAWDRLTTLFC
FVRDSLVDGWRPFELLAPGGQKLTESEEVALAECNLVPAALLTFSWDAAVQADITAAGGS
SSAILKPELLETLWTLS
Download sequence
Identical sequences G3PN62
ENSGACP00000019045 69293.ENSGACP00000019045 ENSGACP00000019045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]