SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000019076 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000019076
Domain Number 1 Region: 3-159
Classification Level Classification E-value
Superfamily RUN domain-like 6.02e-48
Family RUN domain 0.000000084
Further Details:      
 
Domain Number 2 Region: 526-584
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000307
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0061
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000019076
Domain Number - Region: 357-427
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0102
Family Mitotic arrest deficient-like 1, Mad1 0.008
Further Details:      
 
Domain Number - Region: 201-248
Classification Level Classification E-value
Superfamily Prefoldin 0.0201
Family Prefoldin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000019076   Gene: ENSGACG00000014452   Transcript: ENSGACT00000019114
Sequence length 588
Comment pep:known_by_projection group:BROADS1:groupXIII:18982291:18991865:-1 gene:ENSGACG00000014452 transcript:ENSGACT00000019114 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNMGQLSIKGLIESALNLGRTLDSDYAPLQQFFVVMEHCLKHGLKTKKTFLGQNKSFWGA
LELVEKLTPEAGEITASVKDLPGLRTPLGRGRAWLRLALMQKKLSDYMKTIINRKDLLSE
FYEANALMMEEEGAVIAGLLVGLNVIDANLCMKGEDLDSQVGVIDFSMYLKDGGHSSKSA
EGDGQITAILDQKNYVEELNRHLSASVNNLQAKVDALEKSNTKLTEELAVANNRIITLQE
DVERVQEESSYQLETRKVSASSSLGSASRSESAPDGQVLGETRKQLKEETLLRLDVEKEL
EVQIGMKQEMELSMKMLEKDVCEKQDALVELRQQLEDLRVINQQLSHKSQSADAGSKQKS
EAIARLEEKINQMSGTVKQMETRCKQAERERVLALEANRLFKQEFGDKIESLQVEVEQLR
KHRSHLELELRKERHRHGDGSSSQSGVPRRETRLPEDIANIPKVQLRVTTRPSIYIGQKG
ERAVQHGNRGQNQSELQLCLISEASTNPSLVYYVQDEEEEEVCQPSICSMCERDDSLTKT
KRRCKNCEGVFCEGCVSNELPLASSILPETVCTACYSLLLQQYASTPT
Download sequence
Identical sequences G3PN93
69293.ENSGACP00000019076 ENSGACP00000019076 ENSGACP00000019076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]