SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000019119 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000019119
Domain Number 1 Region: 19-116
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000186
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000019119   Gene: ENSGACG00000014489   Transcript: ENSGACT00000019157
Sequence length 491
Comment pep:known_by_projection group:BROADS1:groupII:3540200:3544246:-1 gene:ENSGACG00000014489 transcript:ENSGACT00000019157 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQGAKEEPAQRKEPKFLSKAGWVKKAPGRLLASYKDRYVHVERTEIVVYENEDLQNCLER
VNLENYDKCHELKSPFKKKHRLVLIRSPRPGNKVHDVKFQAQTREKEAWIKALTDGINRA
KNKVFDDVTIDNSINLEHVTRTRPKGNRNRRPPTRMHMKFIVADVSSDGILRLDLNLEDA
VMPNGTCRASDDKKVIKPPMPPIKEAKPCPTPEAEPDKEDGPEKKVLKPPMPPSNKAKPC
ASPLGDATEEDDKPESPGVVRHISEEEPEEAAGSDLSKASDTEPQIPTETLGKSLSPPMI
PKKKSEKPVQPDTPHTGNNANVTQINEGRDPTASPPTASDTSAGSPQAEEALPNEDEIPI
RLMPTKVPPKPQVRPRVFPSRKPRPPLLLKPSDKAKSASIGDLLSSVNVPARQNTADVAA
GNGAPGANVMKLETEVAQEMEKTRDLMSKVSRSQNGGDRKDKTEDLLARAMENLEKADHV
LREVNKLKVAN
Download sequence
Identical sequences G3PND6
ENSGACP00000019119 ENSGACP00000019119 69293.ENSGACP00000019119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]