SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000019120 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000019120
Domain Number 1 Region: 113-194
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000411
Family Phosphotyrosine-binding domain (PTB) 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000019120   Gene: ENSGACG00000014493   Transcript: ENSGACT00000019158
Sequence length 194
Comment pep:novel group:BROADS1:groupI:22159095:22160780:-1 gene:ENSGACG00000014493 transcript:ENSGACT00000019158 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFVLQTVSGVHLGINEIAEGHNQERSLPAPSSPPSSPSCSSTQTRPPAESPLRSPWVTDG
QMEQDPDSQQHHHELQSSPPSRPYEELFCSSQGSHAVGPLTGALVTSCGPHSDVVKQGFL
GKLDRNHRRYFVLRAGSHTGPGRLEWYKNQEKSAGKAALSGSSKLGVMYLRCCLGVSRSG
SSRKGHTVALYAKD
Download sequence
Identical sequences G3PND7
ENSGACP00000019120 ENSGACP00000019120 69293.ENSGACP00000019120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]