SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000019138 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000019138
Domain Number 1 Region: 10-127
Classification Level Classification E-value
Superfamily PH domain-like 1.28e-23
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 
Domain Number 2 Region: 146-219
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000139
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000019138   Gene: ENSGACG00000014509   Transcript: ENSGACT00000019176
Sequence length 283
Comment pep:known_by_projection group:BROADS1:groupII:3599251:3605384:-1 gene:ENSGACG00000014509 transcript:ENSGACT00000019176 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GKWFLFTQNNRERIRAVENSFGPSGKPLYEPGRFLLGEGRLVKMTRKGPQPRRFFLFNDL
LVYGSIIGRWHKKQMIIPLEGCQLEDLENGLSIKNQWLIRTPRKSFYVAAASQEEKRAWI
QQIEDCRSILLQNRGCRTSSHFAKTCIPDSASAICMRCFDRFSVTQRRHHCRKCGFLVCA
ACSKTRAVIQHIHPTKCWRICTGCHTNSSTRTTEEAQRVCHWNDRHTERRSSGSKRRYSD
GEDGSSEEEEAEEQMEDDDPKWLNSQMENWSIYVNLQPQHMQP
Download sequence
Identical sequences G3PNF5
ENSGACP00000019138 ENSGACP00000019138 69293.ENSGACP00000019138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]