SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000019140 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000019140
Domain Number 1 Region: 385-479
Classification Level Classification E-value
Superfamily PH domain-like 4.66e-21
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 
Domain Number 2 Region: 44-180
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000466
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000019140   Gene: ENSGACG00000014506   Transcript: ENSGACT00000019178
Sequence length 941
Comment pep:novel group:BROADS1:groupXI:15486887:15502601:1 gene:ENSGACG00000014506 transcript:ENSGACT00000019178 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGEKATSPCNKFQANIFNKSKCQNCFKSRELHLLTDNGREQAKPLYGGWLCLAPEGTDF
ENPMQRSRKWQRRFFILYEDGSLSFALDELPSTLPQGTVNLNVSADIADAEPRTGQRNAL
CIATPEQEIFIRGDNKEIINGWTEQLAVYLRTSQQNQKKKRKVEPVATQEPSAAKMAAAD
PSSPSLGNAAESGSGTITAIEVLWQSNNRQRSGVLGAPSPAQAQLSSRPPRWSCEFREAA
LPVRHSSSACFCWGNNAAKKKALKGLWFLRGKCKESIKGKANEIAALGLPDRPQHDSHHQ
VLLRRPRHRDDGALSSPQSSSGTRGRVDRSLKKRVFPEPVFFSAQKLQSRGDTARLAAPP
PQRRAKSLDRRTSDTVMTPDLLNFKKGWMVKLDENEQWKKYWFVLSMDSLRCYKDSVAEE
ASDLEGEIDLTRCYNVSEYQVQRNYGFQIHTPKGVFTLSAMTSGIRKNWIQALMKSVRPA
RAPDVASLPVHRGPTEALPKPDVTRDSGAAPPERDPRPERRTVTERRRKGRYKTFDWAEF
RPQGKQAADPPRATAPCSLEIGELESMLGFPLGWEAGPDNKAPGARALSPKSQRRVEEEI
EECWRQVEKTVFRLERKVPLLNVPRETEEENKGYLLRCFEATEAKLTELERKLEQSERTC
MELHAQNAELREAQERCGRRAAEAEADFLQATCERGFASMEESHLKVVEELQHRHRQEVE
RLLVERDGLLEEESAATATAIEAIKNAHRLELEKEVQRRCQSQDTTGSTHLEDVHRQHRE
ELASYQRELEVLSQQFSLKCLENGHLVQAVDAERKALCQCQQENQDLRTRNQELSGHLAA
EITRLCSLAKQDALPLSQGMDVYEMEITLRVKESEVQCLKQEITSLRDDLQAAQRDKRSA
TKKCKDVYAELSITRAKAEREMEALRENLRLAHRALDHNTH
Download sequence
Identical sequences G3PNF7
69293.ENSGACP00000019140 ENSGACP00000019140 ENSGACP00000019140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]