SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000019157 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000019157
Domain Number 1 Region: 21-123
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.32e-25
Family Ras-binding domain, RBD 0.0064
Further Details:      
 
Domain Number 2 Region: 953-1019
Classification Level Classification E-value
Superfamily PDZ domain-like 1.18e-19
Family PDZ domain 0.002
Further Details:      
 
Domain Number 3 Region: 212-332
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.0000000000000684
Family FHA domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000019157   Gene: ENSGACG00000014516   Transcript: ENSGACT00000019195
Sequence length 1020
Comment pep:known_by_projection group:BROADS1:groupXI:15529253:15546887:-1 gene:ENSGACG00000014516 transcript:ENSGACT00000019195 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSTVFNDLQAADDPSELSSQMSVPGILKIFGCDICQGTNYKSVLATTQSSAKELVKEALE
RYCLEKEDAGHYALCDVIGKTGADNQWKRECFRVVGDNEKPLTLQSLWKPKEGFSRRFEI
QLRASVEEQSLQDRDTVTAGINAQARKLQKSRSRVTSLFVDGSGEDADGLGIWRSLSEMD
LPAMGKEAGRAAKSALREDPEAEADNHPPFDFPYFLLLQGYSHRQDFVIYLMSGTTTVFG
CCREHCNGEDEERLKVDILLFAPDVLPQHCCVRRLESSGPPSPGEHRKTLTMLKPLHGAP
VTRNGFLLKEEVELKPGDLVSLGKHYLFMFKDPTSTSASVQTPLWMNPLCPNSDAKAASS
CSSCGSSVAMTRPWRKPSPPRWRDLEGTEALVSYELQQEERVLQEVLDMLDPGGDGPKLA
PAFLLSLCMQHSACTFGLAHFRQLLLRIAAQIQLAMWEKTKELAAIQPETGSDAEQPERL
QVLSMEELIPGLQPLLLWMANSIELLHFIQHEVPQLLPWRQDQQDTGLLDSEMSSTRTAC
EEAMTVLEEVIMFTFQQSVYYLTKSMYSSLPGLLDGNPFSESGQLRVPDGLGGVLEVLKE
ALKLLAAFQVHPDISLQLCAYLLFFINASLFNALMERGSGAGFYQWSRGVQIRANLDLLM
DWIQSIGLGDLANEYFQKLSAAVNLLATPRETLQQASWASLRAEFAALNGAQLHHMLTEY
HSGKPCPPGWSPPAGDAEDAARTADILESFDSHPPLILPDGPFHLELGKAVVEPALFQQL
AQLQEFIRRLPRGETRAEPPAEEQVTSPPRPPSTLVFLHLCLIDFMITRLSTGRLQTASL
LPSWIRPSRGPRPGYLPRPHRDASGHDDMGYHKSLALDPSCLLTPPNTPQGMELAGPAWG
GCCMLGIARGSLGREGGGEGRYCCCVVVVTRRAGGRADRKTQSAEEEEGGAREEVFAVEL
HRGPHGLGLALVDGSKTQLRLSGVYVKSVVPDSPAARCQKLRMGDRILAVNGVSVVGMEY
Download sequence
Identical sequences G3PNH4
ENSGACP00000019157 ENSGACP00000019157 69293.ENSGACP00000019157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]