SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000019172 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000019172
Domain Number 1 Region: 76-266
Classification Level Classification E-value
Superfamily Sec7 domain 6.54e-70
Family Sec7 domain 0.0000000775
Further Details:      
 
Domain Number 2 Region: 274-391
Classification Level Classification E-value
Superfamily PH domain-like 4.72e-30
Family Pleckstrin-homology domain (PH domain) 0.0000095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000019172   Gene: ENSGACG00000014532   Transcript: ENSGACT00000019210
Sequence length 409
Comment pep:known_by_projection group:BROADS1:groupXI:15568711:15575377:-1 gene:ENSGACG00000014532 transcript:ENSGACT00000019210 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSFYPAENTHRSKITPPKRQAHTTGIHKFELLDDIRKLRLEINDITAEIQSPELKEQDQK
AARQLTRCEDKNVVKNRRFLRGKKKFNMDPKKGVRYLVESELLEWRAEALAEFLYKEDGL
NKTAIGNFLGEREEMHLQTLKAFVGLHEFSDLNLVQALRQFLWSFRLPGEAQKIDRMMEA
FATRYCDCNPGVFQSTADTCYILSFAVIMLNTSLHNPNVKDKPGLQRFVTMNRGINNGQD
LPAELLTKLYASIRSEPFKIPVDDGNDLTLTFFNPDREGWLLKMGGRVKTWKRRWFILTD
SCLYYFEYTTDKDPIGIIPLENLCVEKLCDSSKPYCLELFNPKGQKIKACKTENKGRVVQ
GKHQSYKLSAAGPEERDAWISAIRASITKDPFYDLVSLRKRKVISNTSS
Download sequence
Identical sequences G3PNI9
ENSGACP00000019172 69293.ENSGACP00000019172 ENSGACP00000019172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]