SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000019183 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000019183
Domain Number 1 Region: 131-241
Classification Level Classification E-value
Superfamily PH domain-like 5.53e-34
Family Phosphotyrosine-binding domain (PTB) 0.0000538
Further Details:      
 
Domain Number 2 Region: 7-108
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000474
Family Pleckstrin-homology domain (PH domain) 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000019183   Gene: ENSGACG00000014541   Transcript: ENSGACT00000019221
Sequence length 330
Comment pep:known_by_projection group:BROADS1:groupII:3712432:3731892:-1 gene:ENSGACG00000014541 transcript:ENSGACT00000019221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASNFNDIVKQGYVRMRSRKLGIYRRCWLVFKKSSSKGPRRLEKYPDEKSAYIRAFPKVT
EISNVKNITRLPRDTKRQAVAIVFTDDTARTFTSHSELEAEDWFKTLSIECLGTRLNDIS
MGEPDLLAAGVQCEHTERFNVFLLPCPNLDIYGECMMQITHENIYLWDIHNPRTKLVTWP
LCSLRRYGRDATRFTFEAGRMCDSGEGLYTFQTREGEQIYQRVHSSTLAIAEQHKKVLLE
MEKNSRLMSMGSEPCSYPCTPTAILPRSVYWHHITGNQTGLDGSGDAAEDDLLSTRLPLD
HHATLPLAHAHSQPHIHTQSPTHYPTYPRQ
Download sequence
Identical sequences G3PNK0
ENSGACP00000019183 ENSGACP00000019183 69293.ENSGACP00000019183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]