SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000019246 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000019246
Domain Number 1 Region: 36-295
Classification Level Classification E-value
Superfamily Ras GEF 7.32e-73
Family Ras GEF 0.0000813
Further Details:      
 
Domain Number 2 Region: 457-573
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000315
Family Pleckstrin-homology domain (PH domain) 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000019246   Gene: ENSGACG00000014587   Transcript: ENSGACT00000019284
Sequence length 582
Comment pep:known_by_projection group:BROADS1:groupVIII:19217455:19249928:1 gene:ENSGACG00000014587 transcript:ENSGACT00000019284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLPDGHSGITAPAAPVSEKSSSSGSLSDKGSSDLKKSFDAVVFDVLKVTPEEYAGQITL
MDSPVFKAIQNFDELSSCGWNKKEKHSSSPNVVAFTRRFNQTSFWVVREILHAQTLKIRA
EVLSVYIRTAKKLCDMNNLHAVMAVVSALQSAPIFRLSKTWALLSRKDKATFDRLDYLMS
KEDNYKRLRDFISSQSMVSCIPYLGMYLSDLTYIDSAYPSTGSILENEQRSNLMNNILRI
ISDLQRSCTYDVAVLPHVQKYLNSVRYIEELQKFVEDDNYKLSQKIEPGSSTPRVNPPRE
GRSTRLLLLSLVLSHLPPCPPPPGQEASASPLRARKCSIKGGGLIFARLVRGGMLGRVLG
PLPFFLFFLRCLQEHYALKMCLRFASMTDGLSDVGSSEGSELSEEVSWPAFESSSVIHFH
YLHNLSKLPDNAKGRSMTSSSSSAESEELAHLYPGAVTMRGVLRRKTVLKEGQETHQVAS
WTKYWVALCETQLYYYAAKSLKASDRKHFKSTCSKCVCVVGLMTMMADDPEHPDVFLLTD
SEHGGNTYKYQAGNRMNALLWFKHLSAACQSIQVPANLMSFE
Download sequence
Identical sequences G3PNR3
ENSGACP00000019246 ENSGACP00000019246 69293.ENSGACP00000019246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]