SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000019373 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000019373
Domain Number 1 Region: 314-523
Classification Level Classification E-value
Superfamily Ras GEF 7.32e-20
Family Ras GEF 0.012
Further Details:      
 
Domain Number 2 Region: 1-103
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000000000188
Family SH2 domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000019373   Gene: ENSGACG00000014673   Transcript: ENSGACT00000019411
Sequence length 615
Comment pep:known_by_projection group:BROADS1:groupXIII:19662496:19669124:1 gene:ENSGACG00000014673 transcript:ENSGACT00000019411 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RQVSESLVVNHGDFLLRDSQSRRGDFVLTVRWEQKTLHFVVTATAAVRSSETDPGVRYGL
GAEAFDCLPDLVGFFAGSGAALSRWSAARILRPVNRTLPLGYLETAFGAAVSPPSCRRGL
KGGSSEEEVRPGSDTLRSDRTVRPSEPPTFEHPKKKQDNVRLRCIRLDRRLNGHGDMSPA
SSTTGTRTRLCTHRCVRSPRVPRACSLPRSRRPTGPSSGSAASPRGQSSGRASQVGYATQ
SRTTTRCSTESAFVASDSRSRGPSQEAPPPDDPGSCYTELQPGPRSYVGRLRAEGGNAYQ
SPVVETASSFAPSRYRSPLMPAENRPLEAGVLRRVKELLAEVDARTAARHITAADCRVAR
ILEVTPEAQRMMGVSSGMELLTLPHGQRLRLDLLERFQTMATTLAVDVLGCTGTTEERAG
LLHKIIQVAAELKGTTGDMFGFAAVMRALELPQVSRLEQTWTALRQRHTEGAILYEKTLR
PFMKSLNDGRESCPLAGTTFPHVLPLLSLLEKGVTVGEWAEPWETAEAGLDVVMFHLGAA
RTIAQLGGVYRSNAESKLQGFPEQPEVLELFLTDFQMRLLWGSRGAEESQALRHAKFDQV
LTALSNRLEPPVRPR
Download sequence
Identical sequences G3PP40
69293.ENSGACP00000019373 ENSGACP00000019373 ENSGACP00000019373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]