SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000019508 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000019508
Domain Number 1 Region: 50-205,260-435,468-579
Classification Level Classification E-value
Superfamily Ras GEF 4.84e-116
Family Ras GEF 0.00012
Further Details:      
 
Domain Number 2 Region: 692-788
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.32e-38
Family Ras-binding domain, RBD 0.0000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000019508   Gene: ENSGACG00000014771   Transcript: ENSGACT00000019546
Sequence length 819
Comment pep:novel group:BROADS1:groupXIII:19963487:19976413:-1 gene:ENSGACG00000014771 transcript:ENSGACT00000019546 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLVPQSSTQEIAEEAEEDAIFTITLRKVQLHQSASKGQRWLGVETDSALSLYETCKVRTI
KAGTLERLVEYMVSAFRGKDSTYVTIFLCTYRSFASTRQVLDLLLNRNDRLIERPSSHRA
TLVEPPSDSHQRPSHRTTVTVSSILGAWLDQYSEDFWSPPSYDCLHQLMSYLHRHFPGSD
LERRARNLLAHFHRRQQQCEPEPDGMKAGQEGPGGGEGAPGEFKGLLAGGEGGGGVEEKT
TGRCGGSVVKEAVFFCLDPPGEHIGCPFATQEESGFEDELPAFSFLSFDPIMVAEQFTLM
DADLFKKVVPYHCLGGIWSQRDKKGKEHLAPTIRATVAQFNSVTNCVITTCLSNPTLKPN
QRARLLERWIDVARECRILKNFSSLRAILSALQCNAVHRLKRTWEEVSRESFRTFRELSE
IFSDDNNYSLSRELLVKEGTSKFATLEINPKRAQRRHQQQRDLGVMQGTIPYLGTFLTDL
VMMDTAMKDHTEGGLINFEKRRKEFEVIAQIKLLQLASNNYSFTQDAHFREWFSGVEKLS
EAESYNLSCEIEPLSESASNTLRAKKNGGIMKRWSDRQLTEAGCSGVPGSHSKSFDHSHY
RPYQGGGGGGGDSGDALSVTSVSSSGSDLEDVNASFLSDSPEGHERKFWECTSLSSLDTS
GSASGSSSTPLSASRSHKRSASAVSNYSTLSLPLYNQQVDDCCIIRVSLDVENGNMYKSI
LLQVTSQDKTPAVIRKAMIKHNLEREKTDEYELMQKISEDKELRIPDNANVFYAMNSTAN
YDFVLKRRGLARPLRAKNVTSSTLPRMKQKGLKIAKGIF
Download sequence
Identical sequences G3PPH4
ENSGACP00000019508 ENSGACP00000019508 69293.ENSGACP00000019508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]