SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000019515 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000019515
Domain Number 1 Region: 426-664
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.53e-55
Family DBL homology domain (DH-domain) 0.0000242
Further Details:      
 
Domain Number 2 Region: 661-786
Classification Level Classification E-value
Superfamily PH domain-like 3.48e-34
Family Pleckstrin-homology domain (PH domain) 0.0007
Further Details:      
 
Domain Number 3 Region: 228-290
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000155
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000019515   Gene: ENSGACG00000014778   Transcript: ENSGACT00000019553
Sequence length 1140
Comment pep:known_by_projection group:BROADS1:groupII:4687644:4712645:1 gene:ENSGACG00000014778 transcript:ENSGACT00000019553 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GEAEEEAKDRVTEVPRRSSILRNSLRSLSPLRRHSWGPGKNNGADSEMNQRSYSLEGLSA
AQEELRGPTTHRSRILEASRMPRRDGDHRGSLVSLTEEQEDLGQHGKLHDLFSDCLCLSP
QKSRRYRPLRNSGPPMTLPLTKSVSMLAISQRDTDGMRSFSSASGSLAYRSADSISEEEP
GPLRSDTEGKSVTKVSRTFSYLKNKMYKKTRVREREKDRDKREKDKEVKEKDKKTINGHL
FTPVSPGQAAQCFQCNKAFNSKEAFQCTHCNASVHKSCRDSLPVCAKVKMKPPKQQFSVP
DSSLFPTVTMRNKSGGTRERPWSAILSPEEHPSLMIPSRRHTSIMTFHGNNLSKSLSISN
IAGPVFDDMPIKGLRYLSQSTDSLNRTNQVTESMESLTDEGWTEMMDGQLMGEFEAEAKE
LEADSWSLCAEQQQYLQQLDKELAKKQDVIYELMQTEMHHIRTLRIMSEVYSKGLQKEVQ
LELQMLEKLFPAIDELLELHTQHLLRLLERKKESQLQGGSMEGGFIINRIGDILVSQFSG
CKGESMKRVYGRFCSRHNEAVNFYKDLLTKDKRFKAFIKKKMSSSIVRRLGIPECILLVT
QRITKYPVLIQRILQHTKESEEDHEDLTDAVRLVKEVIAAVDNKVNEHEKRRRLKDFHGR
MDSKSIMMTKSGQIFAKEDLLRRRLIHDGMLQLKNCQGRPKDVHALLLSDVFVFLQEKDQ
KYVFAMLDQRCTVISLQKLIVREVANEERGLFLITTGIEKPEMMEVLAGSKDERNTWMQL
IQQAMQSMEKDEDEGIPSETEDDKRQLETKAKEMRDMLRQKDTEIMSLLEEKVQLFRGMW
EPLNPVTETMVPVHCPVLRQPCSSDVSELLQWSPLFKPAATSVTVETLQGLVNGSLGGAM
VDIQEGGGAGPVCLPRRAETFGGFDSHQMHSSKSGDVEESEDTAGDLRRTESDSVLKKGG
NGNMLQLLKRNSEQFLHSVSNLHYLLSTLQAVVVQQDSFIEDQRQALSERASSSSSSLTS
LSRASSRPSSLIEQEKQRSLEKQRQELAALQRQQAAHDTQHMQREMKTAVEAQQLQKIAF
LGVKKEEEVLKLQGQLEEEKHGLQGRKEEYQRDLERLRDAQRKLERDREAVQRELDKMEE
Download sequence
Identical sequences G3PPI1
ENSGACP00000019515 ENSGACP00000019515 69293.ENSGACP00000019515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]