SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000019534 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000019534
Domain Number 1 Region: 606-799
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.73e-57
Family BCR-homology GTPase activation domain (BH-domain) 0.0000517
Further Details:      
 
Domain Number 2 Region: 415-530
Classification Level Classification E-value
Superfamily PH domain-like 2.14e-19
Family Pleckstrin-homology domain (PH domain) 0.0088
Further Details:      
 
Domain Number 3 Region: 15-83
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000197
Family SH3-domain 0.0018
Further Details:      
 
Domain Number 4 Region: 317-349
Classification Level Classification E-value
Superfamily WW domain 0.00000326
Family WW domain 0.0035
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000019534
Domain Number - Region: 279-302
Classification Level Classification E-value
Superfamily WW domain 0.00178
Family WW domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000019534   Gene: ENSGACG00000014793   Transcript: ENSGACT00000019572
Sequence length 801
Comment pep:known_by_projection group:BROADS1:groupXI:15952246:15961744:1 gene:ENSGACG00000014793 transcript:ENSGACT00000019572 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSGPGSIGLGLVLVEFDYEYQGRDGTTISIKPNERYVLLAKTNNHWWQVQRDQSSKSFYI
PAKYVKELPTVPVAVPVAVPVPVPKTLEESRTQPGDDVMIRVRTDATKRYRKTENRMSTF
GFPLDSPDTSSLSAPRHSSNPLAGAAETGTTNMADKKHLPGFAEDHRDSDKHRAPSFSPA
DPVSSPRNQTQPIAVEMPVVPVTHPHYDSSLPSTGRRDNRESSTEEELCVEESSSEEDPV
KEEDSNHIYESIQDLNLDLEALPRLPPQPTGRLAGKVHTDRDSGQEFYFHPVTRRTTWSN
PQGPPPALDEELDRSKPSDGGWQQLVDKASGRVYYHDPSSGTTSWAPPVYNVSPLPQRMM
GNGVSEEETTLEGKYWTHTVVEEVHDVVRPLPCRDTFPSGPAGLKKPEVQGHLLEKAGIM
NKTKVVDHGKKIRKNWSQSWTVLHGGILTFHKDPKTSCLQSKTSQIVPEYTVELRGASVS
RAARDKSSKKNVLELKTRQGCEYLMQYDTESIISDWLKAMQDTIRQLVTTTPDEGGVMFL
EQDHVSEDEDEATSDKEDKDRKRTTSRTSPGMVDSEQRHVRTKLLRFLQRRPTLQSVKEK
GYIRDSVFGCHLDTLCQRENNTTPKFMEKCIRTVERSGLDVDGIYRVSGNLAVIQKLRHK
ADHEEELDLEDGQWEEIHVITGALKLFLRELPEPLFPFSCFDKFIAAIQVQDYSLRVSYM
KDLVRSLPLPNHDTMELLFKHLRRVVEHKESNRMSVQSVAIVFGPTLLRPQTESSSMTIH
MVFQSQIVELMLNEFQTVFSE
Download sequence
Identical sequences G3PPK0
69293.ENSGACP00000019534 ENSGACP00000019534 ENSGACP00000019534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]