SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000019596 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000019596
Domain Number 1 Region: 409-678
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.02e-70
Family Protein kinases, catalytic subunit 0.000000072
Further Details:      
 
Domain Number 2 Region: 852-993
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 3.27e-54
Family FAT domain of focal adhesion kinase 0.0000116
Further Details:      
 
Domain Number 3 Region: 139-260
Classification Level Classification E-value
Superfamily Second domain of FERM 3.53e-39
Family Second domain of FERM 0.0000203
Further Details:      
 
Domain Number 4 Region: 38-137
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.61e-30
Family First domain of FERM 0.00085
Further Details:      
 
Domain Number 5 Region: 262-365
Classification Level Classification E-value
Superfamily PH domain-like 8.61e-27
Family Third domain of FERM 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000019596   Gene: ENSGACG00000014838   Transcript: ENSGACT00000019634
Sequence length 1005
Comment pep:known_by_projection group:BROADS1:groupI:22919039:22927647:-1 gene:ENSGACG00000014838 transcript:ENSGACT00000019634 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGDSCTLQWRSMSPTSPPDSSDTSPPATVGRDSIFPAKIIKVCFLSNNCNLGKNFKLVR
CEEGWTVKDIIKVVLSSGCVGPDITHRLCYCMLLKHLKSSEVHWLHPDLAVAELTRRYEQ
QHLEAEWRYDLRIRYIPSDFMEEFKEDTTTMLYFYKQVRSDYMQQYASKVSDGMALQLGC
LEIRRFYKDMNPNGLEKKSNFELLERDVGLDIFFPKELINSMKPKQLRRLIQQTFQGYST
LKQDQCMTRFFTTLAQCYSFTQERFACRLVHGWNLTIDLVIGPEGISQQTENSTPIRLAT
FSQVRSISCSAESDGQALLTVHIEGAKQPLSVNTSSLAVAENMADLIDGYCRLEGASENS
LIIRPGKGIWRDARLKLPDIPQRDRGCKKNNKYSGSDIYAEIPEGENVSSEKHKISRQQV
AVGRILGEGFFGEVHDGVYKSPAGERICVAIKTCKDFSAEVKEKFLSEADLMKNLDHAHI
VRLIGVIEDDPVWIVMELLEHGELGGYLVQEQHTLTTATLTLYCLQICKALAYLEGLNMV
HRNITVKNVLVASPECVKLGDFGLSRYVDEQEYYKASVSRLPIKWMAPESINFRRFTTAS
DVWMFGVCAWEIFSVAQQPFFWLENGQVIDQLESGIRLPKPQQCPPTVYSLLSRCWAYEP
RGRPRFSQLVCSLSDFHRMELEKEARQNRPLTGAAPSGLDHGAEPPPKPSRLHSNTLPRG
THMQAHQSGSQSTSDTGRKSVVESRFHSGSLTRGVKRESLSVQIQLQNAKYVPRKGTARD
TRPVWQKEQERVENTLQRQKRDMMMDKQWLEQEERRIIAEHAVHRSLNIPFLSPSDPPEK
RPMPSPATQCALKPQPTAELDRSGDQVYTAVMAMVKQVVKLKNDVNTRPPSEYPNCVQEV
GITLRSLIQSVDEILPSLHSSVLTEIEGTKKLLNKDLGELIMKMRLAQQNSVTSLREECQ
RQMLAAAHTLALDSKNLLDAVDQARVRANLARPRPASPSAEAPGE
Download sequence
Identical sequences G3PPR1
ENSGACP00000019596 ENSGACP00000019596 69293.ENSGACP00000019596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]