SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000019599 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000019599
Domain Number 1 Region: 733-802
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000977
Family IBR domain 0.0002
Further Details:      
 
Domain Number 2 Region: 31-122
Classification Level Classification E-value
Superfamily PUG domain-like 0.0000000000811
Family PUG domain 0.0072
Further Details:      
 
Domain Number 3 Region: 651-716
Classification Level Classification E-value
Superfamily RING/U-box 0.00000012
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 4 Region: 366-392
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000000628
Family Ran binding protein zinc finger-like 0.0026
Further Details:      
 
Domain Number 5 Region: 818-883
Classification Level Classification E-value
Superfamily RING/U-box 0.0000759
Family RING finger domain, C3HC4 0.023
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000019599
Domain Number - Region: 305-331
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000153
Family Ran binding protein zinc finger-like 0.0042
Further Details:      
 
Domain Number - Region: 256-283
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000706
Family Ran binding protein zinc finger-like 0.0038
Further Details:      
 
Domain Number - Region: 531-566
Classification Level Classification E-value
Superfamily UBA-like 0.0191
Family UBA domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000019599   Gene: ENSGACG00000014841   Transcript: ENSGACT00000019637
Sequence length 1021
Comment pep:novel group:BROADS1:groupIII:5958005:5974913:1 gene:ENSGACG00000014841 transcript:ENSGACT00000019637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPPGFKYRHIAAETMVVDNSVGSNRKETLASLQRLSTALNILEKYGCNLTNPNRPKYWRT
VKHNNPVFRATVDAIQGGRAVLCLYGYSNQLADGLSFPDDVTDPDVGCVAAVTLEVMSLR
IELEMLISPSHYRHSSLQLRVSLKIGLWDISMANPMGRTIQPAITVKGWGAEGENCTICG
IFRISAHCLTCLQGLCSECDRLYHSYPERADHRRTAVSSSSLSSTSSQNSPSSTAPKRKS
QCGWICSLTISSPGRSSSTWRCLHCTKVNSIHDVLCEECEQPRLEPIGSKAEESQPATIT
GPSHASEWQCKSCTMVNAASSILCKVCERPRLATRPPVTPSHPPITPPRPPAPVLGMPGD
PDSQVRAQWVCQFCTYLNYSPATVCEMCDLARPEPAPLPAKLRPPSPVRRVPALPIKPKQ
PPTEDLDSCRQRRMKEEGLKLIQLIRDGEKKGVSPEEVYTSRRAAGDSSILPCKWLKTEL
PLLLDQIREAGKEAQSANGVQLSRAEAKQAWLRAGGDKERAARQALRDRLTKVQELCALG
FSNAARCHEGLRQSGGEVRGALALLQRPLLEPFHKHIWSDKPEPPVDIHHPDKQRICRRL
LAVYDLPSWGRCELALSLLLEHSAPYSLEDVVQAVRESHDREFIKRVLAKECPICLSVFP
HSKMQSLTSCQCSVCCGCFQQHFTIAVRDKHIRDMVCPVCWEPDINDPEHLNSYFSTLDI
QLRECLEPEVYELFHKKLTEQALIKDPKFLWCCHCSYGFIYDGDQLKVTCFQCRNSFCAQ
CKKPWESQHAGLSCEQYQSWKRENDPEYQRQGLAGYLRDNGITCPNCRFQYALSKGGCMH
FCCSQCRYQFCSGCNNPFHTTCAVDECSVSGLHAHHPRDCLFYLRDWEPARLQALLENNG
VAFNTEPPPGTQTAPSPGLCGVIEQKDEGGQQPDSACGAQTQPGHAGLCEKHYREYLVSL
INSHSIDPAPIYSSNELLLACKRYKVDDSRRDGEDGFTFFSRLLKKLMDEVPLGDKVPRK
K
Download sequence
Identical sequences G3PPR4
ENSGACP00000019599 69293.ENSGACP00000019599 ENSGACP00000019599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]