SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000019605 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000019605
Domain Number 1 Region: 242-440
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.49e-44
Family DBL homology domain (DH-domain) 0.0000000809
Further Details:      
 
Domain Number 2 Region: 432-555
Classification Level Classification E-value
Superfamily PH domain-like 4.48e-31
Family Pleckstrin-homology domain (PH domain) 0.0000468
Further Details:      
 
Domain Number 3 Region: 160-223
Classification Level Classification E-value
Superfamily SH3-domain 2.63e-22
Family SH3-domain 0.0000872
Further Details:      
 
Domain Number 4 Region: 2-116
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.53e-22
Family Calponin-homology domain, CH-domain 0.00069
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000019605
Domain Number - Region: 723-791
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0602
Family Myosin rod fragments 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000019605   Gene: ENSGACG00000014843   Transcript: ENSGACT00000019643
Sequence length 800
Comment pep:known_by_projection group:BROADS1:groupI:22930497:22943245:1 gene:ENSGACG00000014843 transcript:ENSGACT00000019643 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSAEQTVTWLITLGVLESPKKSISDPEAFLQTSLQDGAVLCRLLERLRPGTVDKFFQEP
RGESECQRNVTEFVKGCAAFGVEPFEVNDLLQGLNFSKVLNSLVALNKATEDFGVSEDSV
FVPPASHLRIKSFDSLNTQSRSSKVLQPQYRSLDMSEGSACGHVLFRARFTFQQTNEDEL
SFSKGDIISVSRQEEGGWWEGSFNGRSGWFPSNYVRELKGSDKTLDKPKSGALKSPPKGF
DTTIISKTYYNVVLQNILEAEREYSRELQSLLGSYLRSLHPTERVSSVDISHIQGNLEEI
STFQQMLVQSLEEHTKLSEKQQRIGGFFLNLMPQMKLLYVAYCSNHPSAVNVLIQHSEEL
GQYMEAKGSPTPGILTLTTSLSKPFTRLERYPTLLKELDRHMEDQHPDRADLVAAMMDFK
NFAAQCQEVRKKKDLELQILTEPIRNWEGDDIRTLGPVIHMSHSTVHTQDCQESNERYLV
LFPHTLLVLSASLRMSGFIYQGRLPLSGMLISRIEDGENLRNAFEISGSQCDRMQVACNT
QHDLQEWLDLLTQHTHTPATHAHLQKPQSVCHTLPPQPAAPSRHSESRGGSIGHAYHTLP
HPPSFGAALGCSPSWGALEPPNTPKPWSLSCLRPAPPLRPSAALCMKEDLNKSPKNMKKL
LPKRKPDRKPSEEDFTVRKSTAALEEDAQILKVIEAYCTSAKTRQTLNSSSSRKEVHMLF
PEEEKIIVEETRSNGQTVVEERSLVDTVYSLKDEIQGLKQDNKRMRRTLEEEQRARKELE
KIVRRVLKDMNDPTWDETNL
Download sequence
Identical sequences G3PPS0
ENSGACP00000019605 69293.ENSGACP00000019605 ENSGACP00000019605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]