SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000019642 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGACP00000019642
Domain Number - Region: 10-40
Classification Level Classification E-value
Superfamily UBA-like 0.00663
Family TAP-C domain-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000019642   Gene: ENSGACG00000014880   Transcript: ENSGACT00000019680
Sequence length 171
Comment pep:known_by_projection group:BROADS1:groupXI:16221320:16223231:1 gene:ENSGACG00000014880 transcript:ENSGACT00000019680 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSVNMDELRHQVMINQFVLTAGCAADQAKQLLQAAHWQFEEQDRLPQASIPMCWPAHGQG
MCTPRNTPATPPNFPDTITMFSKLRASECPPLSSQAPSMACSPPAPSPGFGSFWACSPPG
HQPAWLPPSSPTGHHLHHHFHLSQTPMWPPAGSQPGGATQTPVVSALHGQR
Download sequence
Identical sequences G3PPV7
69293.ENSGACP00000019642 ENSGACP00000019642 ENSGACP00000019642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]