SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000019658 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000019658
Domain Number 1 Region: 564-752
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.27e-53
Family DBL homology domain (DH-domain) 0.0000000238
Further Details:      
 
Domain Number 2 Region: 757-894
Classification Level Classification E-value
Superfamily PH domain-like 3.41e-37
Family Pleckstrin-homology domain (PH domain) 0.000000737
Further Details:      
 
Domain Number 3 Region: 262-399
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000144
Family Spectrin repeat 0.0087
Further Details:      
 
Domain Number 4 Region: 1045-1096
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000521
Family SH3-domain 0.0015
Further Details:      
 
Domain Number 5 Region: 21-169
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000000615
Family CRAL/TRIO domain 0.0082
Further Details:      
 
Domain Number 6 Region: 356-499
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000024
Family Spectrin repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000019658   Gene: ENSGACG00000014889   Transcript: ENSGACT00000019696
Sequence length 1136
Comment pep:known_by_projection group:BROADS1:groupI:23125880:23140148:-1 gene:ENSGACG00000014889 transcript:ENSGACT00000019696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSDGILQREDAPLCAAEIGSELQKQFAILPGGRSMNGNPVIVFPEFPDFSELEEDEIQNV
LRYLSSIPSVAASAVGFILVIDRRLDRWAAVRATLLRTQGSFPGNLHLVLVLRPTTLLQR
TLSDFLFKYNKDEFKMKVVMLSSVTELHAYIDPGQLTTELGGTQEYRHESWISHRTAIEA
FALMVKTTAQTLQAFGTELAETELPNDAEATTNLLQAHTLKKDNMKEDLQVALSQGGRLL
ECINEPLQTDPEYGMTSDELENLATVQRLLGQLDETETAFDDFWERHRTKLEQCLQLRHF
EQHFREVRGQLDVTSERLSGFSEVSVSPAHAEHVLRELSGLEDRACVDALDRALSLAREG
DRLIDNSHYAEDSIRPKCSELRGACEEISSTMRSKKDLLLRAMELHHALEKASRWCEEGI
FLLASQPVDRCQSQDGAEAALQELERYLDTAPLHAIADCSAICCQYEAVLTTQLRDQVER
VFQKQSSVQEMFEKRRVSLKKLAAKQTRPVQPVAPRPEVKSPLSSPNQERKERRYSADNS
ICKKVTVQLSINFTGSQYLNQKEEENLAVLRRHVMNELLETERAYVEELLCVLEGYAAEM
DNPAMAHLIPSTLLSKKVVLFGNMSEIYQFHKRTFLKELEAYTDCPELVGRCFLERMKDL
QIYEAYCQNKPRSESLWRQCSDCAFFQECQKKLEHKLGLDSYLLKPVQRITKYQLLLKEL
LKYSKGCDGCDDLQEALSSILGILKAVNDSMHLIAITGYEGNLSDLGRLLMQGSFSVWTE
HKKGHAKVKDLARFKPMQRHLFLHQKALLFCKRREENGEGYEKAPSYSFKHSLSMTAVGI
TESAKGDNKKFEVWCNSRDEVFIVQAPTAEIKTSWVNEIRKVLTQQLKAFRDASQQKTPD
SVFPSPTSNSASISLSGGPKNPKKQEEKKAETSSASDSPSSPKHKGEYEPVTSPTTDRSS
VAKKRFTLQGFSNLKSPKGSPLSPEHGSKRHSVKSDPTPFGFKGWNKASLSVDATEENDG
YSSSEDPMNSDPEDEVGTLNPKAPGKYTVVADCEKAGPQELSVKSGDLVQLIREGEEGQW
FVRNLRSSQEGWVAAANLLSLISESKSSQSLSSSGILPTCFVVWSGGARFLSPFLF
Download sequence
Identical sequences G3PPX3
ENSGACP00000019658 69293.ENSGACP00000019658 ENSGACP00000019658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]