SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000019661 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000019661
Domain Number 1 Region: 195-335
Classification Level Classification E-value
Superfamily PH domain-like 6.39e-44
Family Third domain of FERM 0.000000202
Further Details:      
 
Domain Number 2 Region: 85-194
Classification Level Classification E-value
Superfamily Second domain of FERM 2.36e-37
Family Second domain of FERM 0.00000113
Further Details:      
 
Domain Number 3 Region: 490-577
Classification Level Classification E-value
Superfamily Moesin tail domain 2.48e-31
Family Moesin tail domain 0.0000299
Further Details:      
 
Domain Number 4 Region: 2-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 2e-25
Family First domain of FERM 0.00000856
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000019661   Gene: ENSGACG00000014895   Transcript: ENSGACT00000019699
Sequence length 577
Comment pep:known_by_projection group:BROADS1:groupI:23163487:23169768:1 gene:ENSGACG00000014895 transcript:ENSGACT00000019699 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
INVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKK
VTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDENYCPPETAVL
LASYSVQAKYGDYIKDVHKVGYLTHDRLLPQRVLEQHKLTKEQWEDRIQTWHEEHRGMLR
EDSMMEYLKIAQDLEMYGVNYFEIKNKKGTQLWLGVDALGLNIYEHEDKLTPKIGFPWSE
IRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTIEVQQ
MKAQAREEKHHKQMERAQLENEKKKREYAEKEKERIEREKDELMERLRQIEEQTMTAQKE
LEEQTRRAMELEQERRRAREEAERLEKEREAAEEAKAELARQAADQQKTQEQLAAELAEF
TAKIALLEEAKRKKDDEATEWQYKALSAQEDLEKTKEELKSAMTVVPASPGGNAESEHDE
QDENHAEASAELSNEGVSQLDLRSEEERVTEAQKNERVKKQLQTLSSELAEARDETKKTQ
NDVLHAENVKAGRDKYKTLRQIRSGNTKQRIDEFESM
Download sequence
Identical sequences G3PPX6
ENSGACP00000019661 69293.ENSGACP00000019661 ENSGACP00000019661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]