SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000019664 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000019664
Domain Number 1 Region: 319-513
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.32e-47
Family BCR-homology GTPase activation domain (BH-domain) 0.00046
Further Details:      
 
Domain Number 2 Region: 52-153
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000595
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 
Domain Number 3 Region: 164-242
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000723
Family Ras-binding domain, RBD 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000019664   Gene: ENSGACG00000014898   Transcript: ENSGACT00000019702
Sequence length 555
Comment pep:known_by_projection group:BROADS1:groupI:23177069:23181934:-1 gene:ENSGACG00000014898 transcript:ENSGACT00000019702 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RQRMKSQSYRRQSAPSLVITKALTRSKTLSRYGDTHSETCSLVQSFLSGSDRSFLLHGHA
QLKTGMQTQDRHLFLFTDVLVIAKAKSANHFKLKAQVCACEMWTADCMDEVCEGSTDPER
SFVMGWPTCNCAAVFSSAELKDRWLALLKSRIREEKEREEPKTIPLRVYGKGINTFAVTK
TLPVSNSDSTNEVIRLALQQFSIIGNVKDFQLWVISKRDNTPYPLIGHEFPFSIQMSHVR
HTMSQGGGGRDADGQRAMQVEQMQVYKQCQFIMKPRPVELPHASAGDKPFKRRRSLITWA
FWRGSSSHLNELSLASAPRGCLFGRPLGSVCIEDALPKPVMDMMAFLYHEGSWTRGIFRR
SAGARAVRELRDNLDAGGFQLPLSRDHVFLIAGVFKDFLRSIPSSLFRCELHEEWMEVLD
EEDEEEEQVQDVKRMICRLPKENALLLRYLLALLHGIQGNAHENQMTTFNLSVCIAPSML
WPPGAPCSPEVEGEETKRVCELVKFMIEHCQQILGENPSSLFGGPPQRLTDEMGSDSWPY
PLTDSSYDSLDNELD
Download sequence
Identical sequences G3PPX9
69293.ENSGACP00000019664 ENSGACP00000019664 ENSGACP00000019664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]