SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000019677 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000019677
Domain Number 1 Region: 352-713
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 3.4e-113
Family Oxysterol-binding protein 0.0000302
Further Details:      
 
Domain Number 2 Region: 45-155
Classification Level Classification E-value
Superfamily PH domain-like 9.65e-21
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000019677   Gene: ENSGACG00000014904   Transcript: ENSGACT00000019715
Sequence length 718
Comment pep:known_by_projection scaffold:BROADS1:scaffold_74:169156:175548:1 gene:ENSGACG00000014904 transcript:ENSGACT00000019715 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQGEATALRTTETDGKLDVAPQTRTPSSGRASAKSWQYSDHMENIDGYLMKYTNLVTGWQ
YRFFVLNNEAGVLEYFVNEQSRPQKPRGMLPLAGAVISPSDEDSHTFTVNAISGEQYKLR
ATDAKERQHWVSRLQICTQHHTEALGKSNPPPKSRSYSMASQGSGSSPMSLRRPSQNPAA
LFAWSQGNKGSSLYSSKRSLLPDHLMDAREMMTQAQGQHRDLIQSIEGLPPAPGFSPLDQ
DLLMLKATSMATMNCLNECLHILHLQQVARQRGSLGGPTIEWLEPKLPDILKNGSGSLGS
FAPGGGPLEGSGLELSSPESCSFSGEQEDIDAEDETEDSFTDKEEDLGAVEEERSIILHL
LSQLKLGMDLTRVVLPTFILEKRSLLEMYADFMSHPDLFVTITDGGSPEDRMVRFVEYYL
TSFHEGRKGAIAKKPYNPIIGETFHCSWKVPRGPEAPKEPSQGGPDPAASQDPYQVRFVA
EQVSHHPPVSGFYAECQERRMCVNTHVWTKSKFMGMSIGVSMIGEGCLYLMEHDEEYTFT
LPCAYARSILTVPWVELGGKVNINCAKSGYSAVITFQTKPFYGGKLHKVTGEVKHNGTNA
VVCRVQGEWNGALEFSYASGETRGVDVTKLPVSKKSVRPIEKQGPTESRRLWQHVTEALR
QKDIEKATEHKRMLEERQRAEERHRAETETTWRTRHFDREGDGWVYHKPLWKASAPKS
Download sequence
Identical sequences G3PPZ2
69293.ENSGACP00000019677 ENSGACP00000019677 ENSGACP00000019677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]