SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000019789 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000019789
Domain Number 1 Region: 239-312
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000929
Family Ubiquitin-related 0.002
Further Details:      
 
Domain Number 2 Region: 147-225
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000425
Family Ubiquitin-related 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000019789   Gene: ENSGACG00000015000   Transcript: ENSGACT00000019827
Sequence length 312
Comment pep:known_by_projection group:BROADS1:groupXI:16606758:16609009:-1 gene:ENSGACG00000015000 transcript:ENSGACT00000019827 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KPPPKRRRILDPSAIVSVPVYSNKVNRSVRLRPMAAVFTEKDNSADDGLWARFSSREAPA
DVVHLSDSEDEAEVQLETTELAAVRCPSPPESPVQKQSRQVQKKISEIDRKLQAVNSFLS
PEPRDRKCLSEPEEDVIVNPVSERQGSLYSSSVREIPLKIRCRTDVHKVLVLSSTRLSDV
LTQLSIILDVPPPRLLLLREEEELRTDATVGELGLGIADIIECVVMAAQDDSEADSRSSV
TVRLQSKDRDSSQEFSLHRDAPLGSVFSRYLCTMPGVARTTVRFHYDGSKVTDGQTPAQL
DMEDGDIIEVWV
Download sequence
Identical sequences G3PQA4
ENSGACP00000019789 ENSGACP00000019789 69293.ENSGACP00000019789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]