SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000019790 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000019790
Domain Number 1 Region: 1363-1634
Classification Level Classification E-value
Superfamily VPS9 domain 2.88e-40
Family VPS9 domain 0.0023
Further Details:      
 
Domain Number 2 Region: 14-213
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.57e-37
Family Regulator of chromosome condensation RCC1 0.01
Further Details:      
 
Domain Number 3 Region: 514-674
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 2.09e-27
Family Regulator of chromosome condensation RCC1 0.061
Further Details:      
 
Domain Number 4 Region: 1100-1231
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 1.14e-22
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0089
Further Details:      
 
Domain Number 5 Region: 1029-1118
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 2.48e-22
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0049
Further Details:      
 
Domain Number 6 Region: 919-1002
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000247
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 
Domain Number 7 Region: 684-885
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.00000327
Family DBL homology domain (DH-domain) 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000019790   Gene: ENSGACG00000014998   Transcript: ENSGACT00000019828
Sequence length 1637
Comment pep:known_by_projection scaffold:BROADS1:scaffold_74:399866:410524:1 gene:ENSGACG00000014998 transcript:ENSGACT00000019828 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMHYSLSSGDDSGGERGLLHTWKGYSYSVTPDRLLLPGPVLQVALGTRHGVLLVEGGLVY
SFGELPWKQSQVPDSAKPTVEGALSGQRVVAVAAGSFHSGAVTEDGGVHMWGDNALGQCG
LSGLSTVPNPTPVALVDAEAAPPQTVPVLELACGGQHTLALSAQREVWAWGSGCQLGLNV
AVFPVWKPQKVEHLAGRYVLQLACGGSHSLALVRCLGPQDVHRPLVDKCRQCNQLLYTMT
DKEDHVIISDGHYCPPGVELTEDEGRREAPPPTQGLKMSPSEPLLSSRTSTSNSLAPTDG
VVPTQDSEKEESAATDGPLTASDSAPPSRAGGGAVSGVKSSLYPDEQAVKEYLKKLSQAE
QMAKASAGGTLPPAGGLTPASSTLNSLVASCASAVGERVASTYEALSLKKMMNYLPRSGS
PAAGGLTGVVADNTAERVRLEDSMQAKKSSSTGDIREEEAEGLRRRLSLPGLLSQAKVSP
RLLRKACLPRMRAVALTPLGGAVPEAQELFPTLQTEVWSWGRGEDGQLGHGDALDRLESQ
PLCIKSLNGKEVVRLAAGAHHSLALTAQSQVFTWGSNSFGQLGHMESPSTVPRLAKLSEG
IRVWDMSAGERHTLLLADGDCFRPIIYYSGQQEVEEEERPGSYTQQPVLLPFCMDLGYVS
NVSAGGQRCVALSDMNVMGFIASLHELASAERRFYCKLCNIKTQIIRPLLELESLGSTLG
PAATGLLHTLVGRFSLLCHLTGQHAASLTANLRRVRDVSTLLLLDHGSIFLDSYSEYCSA
VGNFHVMGGFQTLTKPSLDFFGKSPELLKRLSECSEENPTMADLLVVLFYLPTRHLHEYA
RLLLKLVTCFEVSSDDYQRLQDSCSKFEALDLQLKRKRKDADNTLHFWKSFPGKMTDSLR
KPGRRLICESSNKALTLQNAGRFSVNWFIVFNDALVHAQFSTHHVFPLATLWLEPIPEEN
PGLHGLKMITPEETFTVLASSPTEKTKWLRSINQAVHRALGGPGQKAEPPASRTASYAFY
KDGRLKEATYEGSWLNGKPDGRGVLKWPDGRIYTGGFKNGLEDGFGEFVAPNKSLNKNDQ
YVGHWKDGKMHGLGTYISYASGEVYDGSFQDSMRHGHGVLRSGKLNTSSPSVFIGQWLQD
KKTGYGVFDDITKGEKYMGMWQDHTRQGNGVVVTQFGLYYEGAFKDNKMMGTGILLSEDD
TTYEGEFSDDWTLSGKGTLTMANGDYLEGSFGGEWGSGLKVTGSYFKPHLFDTDKEKSIA
VRCGRKLGRLCVCAEDKWQAVFEECWSQLGCEAAGCGENTKAWENIAAALTTSRQLLQDS
PEMLSRSHSRTLEGLEVVPQHAGPITMERYHAIRLYLLKACDTSLHPLGRLLETLVAVYR
MTYVGVGANRRLLPQAVNEIKSYFNRIFQIVRFLFQDLPEEGGLIPEPTAVLRDETEPES
PKAGRVVSSSALLLPVLLPRLYPPLFTLYALDKEREDDVYWECVLRLNKQPDLALLAFLG
VQQKFWPVSFTVAVPAPGEMQQVLSSTKDACFASAVETLQQISTTFTPSDKLQVIQLTFE
EITLAVQALVKQDFLWSMDDLFPVFLYVVLRARIRNLGSEVSLIEDLMDPCLQHGEHGIM
FTTLKACYYQIQHEKIT
Download sequence
Identical sequences G3PQA5
69293.ENSGACP00000019790 ENSGACP00000019790 ENSGACP00000019790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]