SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000019808 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000019808
Domain Number 1 Region: 745-1075
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.28e-106
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0000000000469
Further Details:      
 
Domain Number 2 Region: 8-136
Classification Level Classification E-value
Superfamily USP8 N-terminal domain-like 6.41e-46
Family USP8 N-terminal domain-like 0.0000018
Further Details:      
 
Domain Number 3 Region: 180-323
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 7.28e-27
Family Ubiquitin carboxyl-terminal hydrolase 8, USP8 0.00000756
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000019808
Domain Number - Region: 603-637
Classification Level Classification E-value
Superfamily WW domain 0.0445
Family WW domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000019808   Gene: ENSGACG00000015010   Transcript: ENSGACT00000019846
Sequence length 1078
Comment pep:known_by_projection group:BROADS1:groupII:5771271:5778080:-1 gene:ENSGACG00000015010 transcript:ENSGACT00000019846 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAVSTGVKELYLSSSLSELNRKAEIKPDKTNTRSYVQSSCKIFKAAEECRLDRDEEKAY
VLYMKYLTVYEIIKERPDFKQQLEYYMTILGPNSFKKAIEEAERLSKSLKLRYEEVEVRK
KLEEMERQEEKKRREQITEKDGGRSSPKVSSVSKKDSKKVKGQQNELKNAPSKAAVPAGG
ISAERLFHMMKDQTITIIVMDARSHKDFEESHIQVPGQTCFSVPEEAISPGIIVNQIEAK
LPEVSKEHWKRRAFMDYVVLLDWFSSVTDLTLGTTLQSLKDALYKWDNITILRSEPLVLE
GGYENWLLFYPMYTTNAKVRPPRQNVISSIPHLNFSYPSLEEPKPPAPPQPEPESEGHRS
RHVHSITCHVQGLPPGTLFTPITHTQDSGVLNITHDLFHPLILLSQFDRTKKPSVLVSND
PKPCQNGSAKDSSPNGPLAPDRSVKPSLIPNASLSKEEQSQIHSEAVAVMEKAKQEQEKR
KQERRDSDTPSKSMSLDCPPPNHIVNDIKLRLDIGTLSVWLLKMTIAVKFLSLRLTHWLV
LSPSFQSDGPPSFRCLSEMKTTNGQLGLLRTAVHKWAIGSAEVSIPQREPLTRARSEEMG
RSVPGLPVGWMKFLDTVTGTYRYYHSPTNRVHLYPPEVTVPQTPPSTPPTVKQRPTRPAE
PDTSQEQEREQSKLKRSYSSPDISQDLREEAQMKAATPTTAAVIPTINRETKPPNKVYSK
VEIVRPSAAKIRNLNPSFGGLGASLTGLRNLGNTCYMNSILQSLCNTPGMAEYFNNNYYL
EDINRHNILGHKGEVAEEFGVIMKALWAGLYKCISPRDFKITIGKINDQFAGCDQQDSQE
LLLFLMDGLHEDLNKADNRKRYKEEENDHLDDQTAADLAWSKHKLLNESIIVALFQGQFK
STVQCLTCHRKSRTFETFMYLSLPLASTSKCSLQDCLRLFSKEEKLTDNNKVFCRHCKAH
RDSTKKLEIWKVPPIVLVHLKRFSYEGRWKQKLQTHVDFPLDTLDLGQYVIGPKQTLKKY
CLYGVSNHYGGLDGGHYTAFCKNALKQRWYKFDDHEVTEISTPTVKSSAAYILFYSAL
Download sequence
Identical sequences G3PQC3
ENSGACP00000019808 69293.ENSGACP00000019808 ENSGACP00000019808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]