SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000019852 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000019852
Domain Number 1 Region: 3-142
Classification Level Classification E-value
Superfamily PH domain-like 6.82e-48
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00000271
Further Details:      
 
Domain Number 2 Region: 111-342
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000785
Family Tropomyosin 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000019852   Gene: ENSGACG00000015051   Transcript: ENSGACT00000019890
Sequence length 354
Comment pep:known_by_projection group:BROADS1:groupII:5882568:5896033:-1 gene:ENSGACG00000015051 transcript:ENSGACT00000019890 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SREQPIYTTRAHVFQIDPTTKKNWVPASKQAVTVSYFYDSTRNSYRIISVDGYKVIINST
ITPNMTFTKTSQKFGQWADSRANTVFGLGFSSEQQLAKFSEKFQEVKEAAKLARDKSQDK
VDTLSNHSEESGHETQSTPQASSINGTDDEKISHVSPEAAVLQTENERLKSAVEESNTNA
KKWETELQTLRENNARLVDALQESSANVESWKKQLGACKDESDTLREKIAVLEAQCNEAD
REKQQNCQLSVRVQELETELQEKEQELENLRTQAEIIPQLMAECESITAKLQTAERRNKE
LEGRVDGLQLDIEDSQQKQGNMKGELKKFMDMLDGKIDELHEFRQGLSKLGVDN
Download sequence
Identical sequences G3PQG7
ENSGACP00000019852 69293.ENSGACP00000019852 ENSGACP00000019852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]