SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000019854 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000019854
Domain Number 1 Region: 283-410
Classification Level Classification E-value
Superfamily Second domain of FERM 1.17e-28
Family Second domain of FERM 0.0026
Further Details:      
 
Domain Number 2 Region: 414-516
Classification Level Classification E-value
Superfamily PH domain-like 4.79e-23
Family Third domain of FERM 0.0059
Further Details:      
 
Domain Number 3 Region: 56-149
Classification Level Classification E-value
Superfamily PDZ domain-like 2.37e-16
Family PDZ domain 0.011
Further Details:      
 
Domain Number 4 Region: 194-275
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000682
Family Ras-binding domain, RBD 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000019854   Gene: ENSGACG00000015050   Transcript: ENSGACT00000019892
Sequence length 1265
Comment pep:known_by_projection group:BROADS1:groupI:24696762:24711464:1 gene:ENSGACG00000015050 transcript:ENSGACT00000019892 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FQQNANHKNKMSGWPPPGPGSWAGLQGPPYSWDSMSSAREGRDCLTNQVSQCSSLEEVHL
DGVPPAPRLVEMRRDPVLGFGFVAGSEKPVVVRSVTPGGPSEGKLLPGDEIIMINDEPVG
SAPRERVIDLVRSCKESIVLTVVQPYPSPKSAFISAAKKAMLKSNPVKVRFAEEVIINGQ
VPNLVKDNSLLFMPNVLKVYLENGQTKSFRFDSSTSIKDVILTLQEKLSIKCIEHFSLVL
EHRTEGSGSKLLLLHEQEMLTQVTQRPGCEEMKCFFRLSFVPRDPVELLRRDAVAFEYLY
VQSCNDVVLERFGTELKYDAALRLAALQMYIVTLTTRQSQKVSLKYIQKEWGLPLFLPPV
VLSSMKEKNIKKALTHILKTNQNLVPPGKKLTALQAKVHYLRYLSELRLYGGREFNSVLL
QGEKQTEVTLLVGPRYGISHVINTRTNLVALLADFSHVNRIEILTEDETNVRLELHVLDV
RPITLIMEASDAMNLACLTAGYYRLLVDSRRSIFSMPYCNSTGGDDAGELLSPDRVLEWP
YSTSLGDNEEASQSQEEVYNRDSEYPNNGRRENSISSYFREPPNTDRDPGTRRSPLPPPL
PPATRHKPQDSPRSAKVSFIFGGDPPLSQPKQSGYDRLLESPEAPEQRRPYSHNNTDFRP
HDRAPFHFAGLTHVYSNILTEEGGEEPLLRDLFYRDTTDDAEDDDDASCEEDSIGGTPGQ
AAFLAFSGSTDDIIDLTSLPPPEGDDSVMDDEDDTLLQTLNLAIAAPPPGFRDSSDEDAA
PEGRPLSTHGNDDIPVSLIDAVPTQGEGEGSRGGERRLENAVMHTLQALEALSVSDQRPP
PPPPNSSNPGVYSSRGFSPESSSDSGNETNSSEMTEISELAASHRLNESHMRLLLATREG
YQPLLEEKTDFPVSPNTAGTIQKKPRSPNRHLQPPAVPPRRSPLLDTASSGPDSLAVRSQ
TKLSATLQRPSSTTPGGKHHKKSADSSGKYNTFSTRDGHRGESGGSRGRPEMDQRTSFCE
REEGQRRQSSFLEETAASEGAAVNSLPRDHHRIPRPPSASCDRLSDVVTVGHCGADNGAA
AVEQDEHLVVASLMSQTTKSRSAGSDQGSDVQNDHQPISRQQSVARLCEYHLAKRISNLQ
GEAHSSLQGSLCSSLDAGGSTNSSACGTPNDSPLGPGAVESKHHLQRHPLSSSSSSLIRV
LNYEDGKPGIPRGLPSQSGQGRDLHPHADPALLRKMLPNIHPPAGGAEPGRPSSATPSKH
KETTG
Download sequence
Identical sequences G3PQG9
ENSGACP00000019854 69293.ENSGACP00000019854 ENSGACP00000019854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]