SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000019984 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000019984
Domain Number 1 Region: 316-415
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.51e-31
Family Ras-binding domain, RBD 0.004
Further Details:      
 
Domain Number 2 Region: 449-559
Classification Level Classification E-value
Superfamily PH domain-like 4.66e-16
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000019984   Gene: ENSGACG00000015152   Transcript: ENSGACT00000020022
Sequence length 1272
Comment pep:known_by_projection group:BROADS1:groupI:25526859:25540460:1 gene:ENSGACG00000015152 transcript:ENSGACT00000020022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQVSDDELDHGAEEDSDKEDQDLDKMFGDWLGELDKLTQSLDDGKPQKPLQKPPLRQET
NMANFSYRFSMYNINEALNQGDTVDLDALMADLCTIEQELNTISKPNSSSRGQNKGQQRG
PGGRSASTKHTGTSGGGSSGGSPDARPAASNISLDDITSQLEKASLSMDEAARQATLRRP
SSGSSGGGQHRRTGSVGAVSEQEAPSQRSSVNSACASASSMDSLDIDKVMAGGEVEAQSG
PSTQGEVSMHVTLRRARRQLDFNSREGEVDRATHSYLDRETSLILKSIAGKPSHLLTKEE
QAAKLKAEKIRVALEKIKEAQVKKLVIRVHMSDESSKTMMVDERQTVRQVLDSLLDKSHC
GYSPDWSLVETINELQMERIFEDHENLVENLLNWTRDSHNKLMFIERIEKYALFKNPQNY
LLGRKETSEMADRNKEALLEECFCGGSVSVPEIEGILWLKEDGKKSWKKRYFLLRASGIY
YVPKGKAKASRDLVCFLQLDHVNVYYGQDYRCKYKAPTDYCLALKHPQIQKKSQYIKYLC
CDDVRTLHQWVNGIRIAKYGKQLYVNYQEAMKRTEAAYDWSSLSTASIRSGSSSASIPES
QSNHSGHSDSGVDTGTSHGRSQSVVSSIFSEAWKRGTQIEESSKAPQPAPQFPQRPQPSP
QSLQQQLQQPQTIAGYNHMLPLPQQLAPPPPPPPPPPPPLPPLVQAVSHHSPGPTMYKFS
TINRLQNQMASQSANHHRAPTPPAPQVPVNVNHIAARTNVPPPPPPPPPPAMPTPGSAMA
MLKRGPPSPATPPAFIPPPPGPPAPQTNGLAFPPPPPPYPTGQHVYPNGLKQALKERFPS
PPRDLLPPNGVLEESPPPAPQQFNLPAQFPPPPAPPPAPPKTFTPGFVRHTAPKPVSPVS
PFPPAPPPAALAGSEPAPTFNPRFRLGALRSNITLQAGSPPIFPPFFPQGPNRGLSHALS
PRSPLAPVTSRLTLPLPREPRLLSQSHPRVSVSRAESAPARRGLQLQVPRLGSYEESRRN
LLSKFAPPQNSRSPAKDPSTGPRAPPKPGKLNLANLPMALQAKVSQVKQTSGDFPSPPPE
SAYFPPPPPASELFPPPPPPGGDAHSGGPPRVAVVNPQPQAPPPPPPVSLVSNSTWGKSS
LKKTPPPTLVRRSNATPEPAPLSPPPPTSPKGSSGQPNFLDDLHRTLKRKSVGRQGSLNS
AGLAGKPDAVGTMDDMALPPPPPELLLDEGQQSNGGNGAYMSGNISGYATIRRGPPPAPP
KRGDATKLTGEC
Download sequence
Identical sequences G3PQU9
ENSGACP00000019984 69293.ENSGACP00000019984 ENSGACP00000019984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]