SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020025 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020025
Domain Number 1 Region: 4-236
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.95e-81
Family Calponin-homology domain, CH-domain 0.00000263
Further Details:      
 
Domain Number 2 Region: 3010-3133
Classification Level Classification E-value
Superfamily EF-hand 1.44e-49
Family EF-hand modules in multidomain proteins 0.00000278
Further Details:      
 
Domain Number 3 Region: 3135-3231
Classification Level Classification E-value
Superfamily EF-hand 2.18e-38
Family EF-hand modules in multidomain proteins 0.0000047
Further Details:      
 
Domain Number 4 Region: 1003-1160
Classification Level Classification E-value
Superfamily Spectrin repeat 1.1e-26
Family Spectrin repeat 0.0062
Further Details:      
 
Domain Number 5 Region: 2683-2817
Classification Level Classification E-value
Superfamily Spectrin repeat 9.6e-20
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number 6 Region: 405-558
Classification Level Classification E-value
Superfamily Spectrin repeat 2.95e-19
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 7 Region: 529-667
Classification Level Classification E-value
Superfamily Spectrin repeat 3.27e-19
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 8 Region: 3211-3300
Classification Level Classification E-value
Superfamily RING/U-box 2.35e-18
Family ZZ domain 0.01
Further Details:      
 
Domain Number 9 Region: 1221-1374
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000547
Family Spectrin repeat 0.0065
Further Details:      
 
Domain Number 10 Region: 718-829
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000128
Family Spectrin repeat 0.0053
Further Details:      
 
Domain Number 11 Region: 2458-2616
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000144
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 12 Region: 2137-2253
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000209
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 13 Region: 782-940
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000288
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 14 Region: 1830-1968
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000755
Family Spectrin repeat 0.0073
Further Details:      
 
Domain Number 15 Region: 2831-2967
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000196
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 16 Region: 1526-1648
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000232
Family Spectrin repeat 0.0094
Further Details:      
 
Domain Number 17 Region: 1976-2080
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000249
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 18 Region: 2260-2374
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000176
Family Spectrin repeat 0.0084
Further Details:      
 
Domain Number 19 Region: 1657-1779
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000544
Family Spectrin repeat 0.0085
Further Details:      
 
Domain Number 20 Region: 2980-3009
Classification Level Classification E-value
Superfamily WW domain 0.000000312
Family WW domain 0.00079
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000020025
Domain Number - Region: 2397-2470
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000127
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number - Region: 1346-1444
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0201
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020025   Gene: ENSGACG00000015181   Transcript: ENSGACT00000020063
Sequence length 3632
Comment pep:known_by_projection group:BROADS1:groupI:25729705:25866306:1 gene:ENSGACG00000015181 transcript:ENSGACT00000020063 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLVLCKADEREDVQKKTFTKWVNSQLAKTGKLPVEDLFSDLCDGRRLLELLEGLAGREL
VVRLERGFTRVHSLNNVNRALQILQKNNVELVNIGATDIVDGNHKLILGLIWSIILHWQV
KDVMKDVMAGLQQTNTEKILLSWVRENTRQYPQVNVVNFSSSWNDGLAFNALIHSHRPEL
FDWSSVEKKTSAIDRLEHAFNKAEQHLGIVRLLDPEDVAVPHPDKKSVIMYVTSLFQVLP
QSVSMEAIKEVETLPRVSASSVARVTTEEHYQIQTQQRFSQQITVSVAQGRVRSPSPQPR
YKSYAYTQAAYVQSPEQKRRRVTDQFLSPGQEELQRGLSPLPPGSTSLENYQAALEEVLT
WLLSAEDGLQGQPSISDNVEEVKEQFHTHEGYMVELTTHQGNVGRVLRAGAALLAEGNLS
EDEDSEVREQMNLLNARWEHLRVASMERQSRLHEVLMDLQHQQLKHLTDWLDLTEARIKR
MGAQPLGPDLEDVKHQVEEHKLLQEDLEQEQVRVNSLTHMVVVVDETSGDSATAALETKL
QVLGDRWAAICRWTEERWILLQDILLKWQHFTNEQCLFDSWLTQKEELVHSIKTFNLKDQ
AEMVTCLRRLAAVKADLEAKRPAMDKLCSMSQDLLSSVKNKEVASKLEARLDSFAQRWDR
LIQSLETSSFQLSSAASTVQQSELTHSVTATVTKVVSREKVPAAVRQTRESPPPQKKRQV
VVDSELRKRFDVDFTEVHSYMTRGEAILQSPEFSVSRKDGSIQELRDKVQAIERERPEKY
RKLQEATRTAQTLVEQEGSRADDIAQAAEQLNQRWSGFCVLLAERVAWLAYQTKVVLAFY
GLYEQCDQAVDASENWLKVQAPPASEPEPLKAQLDRCREEVTRLASLQPQVELLEAQLKE
LREEKEGEEDPSAFLDADVVAFKEHYHKVLEDLRAREKHLHLVLESLPPARYKETILTLL
AWLQQCEAKLAVPSTAVTELPVMEQRQKDVQALQVALAEHQGEVDYLTSAVEQVFQKAPP
DISQKYRMEMESVLARWRRLGATLTDNGQRLKELTAKLLQFENDVRTLKKWMADVDVFLN
EEWPALGDSEALEKQLEQCTALVNDIHTIQPSVNGINEVGLYLKKEAEPPFAIHIQKELD
ELNGQWENVCKQAYAKKSALKGGLDKTMALRKEMQEMQEWINQAEEDYLERDFTYKTPED
LRRAVEELKRAQEEVHSKELKVKLLTDSVNSFIAKAPPTAHDALRSELDVLTANYQRLCS
RLDGKCKTLEEVWACWCELLSYLEQENAFLDQLEQKLDETENLQGGAEELQEALDGLEVL
LRHPEDNRNQIRELAQTLMDGGVLDEIIQHKLDLFNARWDELMSRAVLRQKELEKSVQRA
QENDKTLRNIQDSLAHTDRHLTAYLADHIDALQIPQEAQKIQSELSGHEATLEDMRKKNE
DKKPSHRILGQIDLTQKMLTDVWTKFRLFQKPANFDTRLAECERLLAGVKSQVGVLDIRS
VEQDVVQSQLDQCMKLYKVLSEVKGEVETVIKAGRQVVQKQQTEQPKDLDDRVTALKLLY
NQLGSQVTESKLELEKSLKLSRKLRKELNGLTEWLAATDGELTRRSAVDGMPGDLEAEVA
WAQSVHGETERRQPQLQTVAELAEALKAVLRGHGGLVDDKVSLLHCNWIAVTSRAEEWLN
LLLDYQRQMQKLDGEIEGVNGWIDGADKKMDEIDSRGPNDAVLKVVLRAELELTRRKVEE
VRSLARDLMSTRGENCQAQVGPKVERLDRRFDTVAQRIASGLTAASAKELEQYHSEVQIW
LELLEEEVKQGENLKEEDFQENKDCEEGAVKELLLKGETLQKRVPNPDKREQIRLKHNEL
KSKYSTVKTAPLPQLRNRKALAIAPQWYQYRRKSHDLLAWLDDIQRSVDQLPDPPEGERV
KEIGTEFDKKKEDLNQVQGLANQLSEAGATNLVEPRQLQLNTRWLEVEGRFIPFKRHCEY
VTELQALLRLVSETDFKLNSPEFWPAAYYNLPQQEQCLKEVKGNVEDLRGPVEGVLARRE
EMSSGARPLESQRIRDTAGLLNANWDKLNKLYHDRLRRWQDCSCKWQRLVADQRAMEEWL
SEAEGALRLAESEPAGHKQHLRDLTEAIPLQEVVLCRVSAAGEDISQLSTPDDASRLRTQ
LKLLGGRWANVCQQLNERKRRSAEARTATAELQEHMGSMLGWLDRAEGVLAAPLQPAEPQ
HIRDTLGKVQAHVDELPAKRAAMEVLNYRHKQISLPAERQRDIRIIGTRWAQVSEALPER
QLELEALLRELEKLQAQLDALSAWAASCRERLQHGPEDPPARLIEEVKVKEPEVESVLKR
ADQLYKEGPHGQPDKMKYVHLREDWVVILELVRQHNERMAVPLVAKKANESLTGSSLPDS
AALAQFNKSWAELTDWLTMLDNMVQNKRVVVADLEDIDDNINSLKVTMQELDQRRPLLER
QVTAAQNLKNKTSNQETRNAITERIDRLQTHWEDSQTKLYDRTKQVHSMQRDSTDWLDAK
KGVDPLVKRASERMECWQEITYTVDTLKKQNAELKLFARELQQWQGQVDETNALAGKLLT
LYANDDTHKVIQVNDNMVVTWTHINRRVSDREAALEAALKLLQQSYLDLEKFLNWLTEAE
TTCNVLIDATNKERMQEQPEAARNLLAQWKDLQVEIDSQTELYHSLDENGQRIVASLGGS
EDGALLQRRLDNMRQRWSDLREKTLGMRAHLDSEMAPWKRLHMSLQELLNWLRLRSQQLE
KESPVGGDVPAVQSQLDTHRGFRRELRAKEPVVTKALDDVEVFLSGLPRDTPSPEQRGIS
PEERAQNVGRVLRKEADDLATRWDGLSGDSDDWQRRLELALDRLMELQEAEDLLDGQLRQ
AAMVKESWEPVDESLLIASLPEHIDRVKEFQEEIAPIQDDVTHMNHLASTYGPPDIQLSP
GNLERIEDLNTRWRLLQLSVNEHLKQLTDAHRDFVLLHAGSVESPFEQGTSPNNVPYYIN
HQTQTTCWDHPKMAELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLSMPMACEVFDQ
HGLKQNEPLLDISMLVACLTSLYQRLEQNHAHLVNVPLCVDMCLNWLLNVYDTGRTGKIR
TLSFKTGIISLCKAHLEDKYRFLFRQVASATGFCDQRRLGLLLHDSIQIPRQLGEVASFG
GSNIEPSVRSCFQFANNKPELEAAMFLDWMRLEPQSMVWLPVLHRVAAAETAKHQAKCNI
CKECPIIGFSRYRSLKHFNYDICQSCFFSGRVAKGHKMQYPMVEYCTPTTSGEDVRDFAK
VLKNKFRTKRYFAKHPRMGYLPVQTILEGDNMETPVTLINFWPVDHAPGSSPQLSHDDTH
TRIEHYASRLAEMENRNGSYLNDSISPNESIDDEHMLIQHYCQSLNQGSPLSQPRSPAQI
LISMETEEKGELERVLNDLEQENRKLLSEYDRLKKAHDRKGLSPLPSPPEMLPASPQSAR
DAELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQTDSKVNGTALSSPST
SSQRSDSSLPLLRVAASQTTDTMGDDELSSPSQDASGLEEVMEQLNNSFPHSQGRSIGSL
FHMADDLGRAMESLVSVMTHEQSAKQQEALPY
Download sequence
Identical sequences G3PQZ0
69293.ENSGACP00000020025 ENSGACP00000020025 ENSGACP00000020025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]