SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020039 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020039
Domain Number 1 Region: 1163-1526
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 2.35e-123
Family Hect, E3 ligase catalytic domain 0.00000000983
Further Details:      
 
Domain Number 2 Region: 186-294
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000672
Family Synaptotagmin-like (S variant) 0.075
Further Details:      
 
Domain Number 3 Region: 937-979
Classification Level Classification E-value
Superfamily WW domain 0.000000000237
Family WW domain 0.0013
Further Details:      
 
Domain Number 4 Region: 771-801
Classification Level Classification E-value
Superfamily WW domain 0.00000000593
Family WW domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020039   Gene: ENSGACG00000015192   Transcript: ENSGACT00000020078
Sequence length 1532
Comment pep:known_by_projection group:BROADS1:groupI:25889267:25906930:1 gene:ENSGACG00000015192 transcript:ENSGACT00000020078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TNGSAREHLLAVRRRTPHTRPYTIGPDNLRTLSGSQQETAGVGLQRANSDTDLVTSDSRS
SLAASSYQLTLGHSHLVISWDIKEEVDATDWIGLYHIDETSVANVWDSKNRGVNGTQRGQ
IVWRLEADPNFMEPETKICFKYYHGVSGALRATTPCITVKNPGVPVGGEGQAEDQSVTEH
CRKLVSFTLSDIRAVGLKKGMFFNPDPYLKMSIQPGKRSGLPKFTHHGQERRSSIIANTT
SPVWHGEKYTFVALMTDVLEVEVKDKFAKSRPIIKRFLGQLIIPVQRLLEGPTTDDQPVS
HSLCRRLPTDHVSGQLSFRVAVTSTGHEEASPEAMGAVLGAVNGDSGSPSDDEDLPHQSS
SSRGAYRPSPRGPDEGSRLVNGPCYYGDDSIWREPAEEDLLAVSLGCHTHRQVSLNDYLD
TIEAPRSPGERPHAGPSPKLRSSFPTDTRLNAMLHIDSDEDEETAGQHRETPQEIRTQDS
TDSALSQRRATSESPQGNEGSGRSGAGAGATAEAGSSARIQPGTEPGDEATEAQAGTSTA
AEPAAGTGAARVTGEAPTSTSSSSQASGTDVQAAAAGQVGAVGECTCQQQSSRMGANQEL
PCNISLGLLSPIQVSSCSLSSSLLSLLPLCPKEVETRKEVAPKAEEEGESSSSEANGPVA
APAPRSSILANQGGGTSDVGRFTVHGRSISNNNIKLVSLHVLPKTTLDYSMQTFGGTAQS
QEACGARGSQNGAVGVERDTAGKTFVPNLQCILNPFGRRQKVGQTSASPSANWEARIDSH
GRIFYVDHVNRTTTWQRPTAPPAPQTLQRSSSIQQMEQLNRRYQSIRRTITNDSRPEEQP
ANELLADETDLQPSTPEVRRDNGVAQSSPRSRLTLLLQSPSAKFLTSPDFFTVLHSNPSA
YRMFTTNTCLKHMISKVRRDAHHFERYQHNRDLVAFLNMFANKQLELPRGWEMKHDHTGK
SFFVDHNCRATTFIDPRLPLQSTRPPSLLAHRQHLTRQRSHSAGEVGDEPRRAGPPVLPR
PSSTFTTPNRGQCPDVVPVAYNEKIVAFLRQPNIFEILQEKQPEFHRNHSLREKVQLLRT
DGGSALARLSGDADLVMLLSLFEDEVMSYVPPHALLHPSYCQSPRGSPVSSPQNSPGTTR
ANARAPAPYKRDFEAKLRNFYRKLETKGYGQGPGKLKLIIRRDHLLEDAFNQIMCYSRKD
LQRSKLYVSFVGEEGLDYSGPSREFFFLVSRELFNPYYGLFEYSANDTYTVQISPMSAFV
DNHHEWFRFSGRILGLALIHQYLLDAFFTRPFYKGLLRIPCDLSDLEYLDEEFHQSLQWM
KDNDIEDMLDLTFTVNEEVFGQITERELKAGGANIPVSEKNKKEYIERMVKWRIERGVVQ
QTDSLVRGFYEVVDARLVSVFDARELELVIAGTAEIDLSDWRNNTEYRGGYHDNHIVIRW
FWAAVERFNNEQRLRLLQFVTGTSSIPYEGFASLRGSNGPRRFCVEKWGKVSALPRAHTC
FNRLDLPPYPSFSMLYEKMLTAVEETSTFGLE
Download sequence
Identical sequences G3PR04
69293.ENSGACP00000020039 ENSGACP00000020039 ENSGACP00000020039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]