SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020042 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020042
Domain Number 1 Region: 775-901
Classification Level Classification E-value
Superfamily Bromodomain 2.49e-36
Family Bromodomain 0.00012
Further Details:      
 
Domain Number 2 Region: 671-735
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.55e-17
Family PHD domain 0.002
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000020042
Domain Number - Region: 65-106
Classification Level Classification E-value
Superfamily STAT 0.0824
Family STAT 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020042   Gene: ENSGACG00000015196   Transcript: ENSGACT00000020081
Sequence length 904
Comment pep:known_by_projection group:BROADS1:groupII:6427212:6433455:1 gene:ENSGACG00000015196 transcript:ENSGACT00000020081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLRIIHAKRTGRREASMGIEENQSVGTPSSAIKRKRKLSVIEAHRSRFLADIYCLFRPQD
EVEQATSLEELEKQIEKLAKQHHQTRRKLFEISHSLRSTMYGQDRYRRRYWVLPHCGGVF
IEAMESGEGSYSTTHAECADLIWQTNSSPPAAPEELEEERQRRRRVAEEVKVKEEPQEME
LQKEKPNDLGGQSIQTRGLELEKDEEKEHEAARPRIQTVHIPGRRQRDGDGKGRGEYPSV
ATTPSTVTNNDTSVPPLASTSLSVPCLPAPCESPGTTPPTSSPAPSPYLSFQANDQLLRV
LTERSGHWFSLLPRNPCDLTSITTPPPGAPRVPPQASSTPAGPRSPPQSPALPLTFSAAS
ASASPHHPAGLLNYPLSALQGNTAASVSSKSESPLPCMEKSSSMPSPTLEMPKSLDHATP
RPIPEESLTGWWRVSDIEQLRALVSALHSRGIREKSLQRQMQKYTEIIPQVCTKHKDVAM
IELRELEESQVSVESVRGWCVQEQAMEMDIAVLQQVEELERKVTAASLQVKGWTFPDPQS
EREDLVYYEHKPPTKSTPGSANAGDKDSKEHPEERGEKGGVMRHLDNPLDIAVTRLADLE
RNIERRYLRSPLGTTIQIRLDNVGTVTVPAPAPSTSADSSEEEVAHGMKVWRKALTEVRS
AAQLAMCIQQLQKSIAWERSIMKVYCQMCRKGDNEDLLLLCDGCDKGCHTYCHKPKITSI
PEGDWYCPACISKLKADNTEASGPSPKNKKPPSKPLTSSGGGAKNRKRKTEESSPAPPAA
NQESPVCVKRAKTAKDNNRDLGLCRVLLAELERHQDAWPFLTPVNMKSVPGYRKVIKKPM
DFTTIREKLVSSQYQNLETFIIDVNLVFDNCEKYNEDNSDIGRAGHNMRKFFEKRWTELL
KQTN
Download sequence
Identical sequences G3PR07
69293.ENSGACP00000020042 ENSGACP00000020042 ENSGACP00000020042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]