SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020060 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020060
Domain Number 1 Region: 42-123
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000259
Family Ubiquitin-related 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020060   Gene: ENSGACG00000015211   Transcript: ENSGACT00000020099
Sequence length 484
Comment pep:known_by_projection group:BROADS1:groupIII:7220760:7225477:-1 gene:ENSGACG00000015211 transcript:ENSGACT00000020099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRKTKKQKDFLDSIERPESGLKFGPFHSRMEQQRGLCSFAPGCQAGVSPGQPTMRLSIT
STAGGPVELTVPRGESVEGLRAQISHRLRLQTDRIVLLYRDTQLTAGQLLDLGVTDGSKL
TLVPAIEAGLVCSAARGERTMMDVLESLTEVQISDFLSGRSPLTVNLGIGAHMMYVQLQL
SAQNVAELQHHQDLRAGASGDLQAGLPTGARMSQPDFSNKTAGSTSQTSTRVPDSSDSTS
SNKLRAERPRTPALPDRSRPAQSTPTPPPVISTPPLPSGQQPAAAPVRSHAPTGSAPGPR
CPASASTPREGDIPASSAAERSKQPGAVIESFVSPSPGVLSGTFTGTLAPCGQRGFSHPR
RGIGIILQIFNDLIRAAYNHQGSQPVPPRNPDGPDSNPPGGVLLPAAEGTRQAEGQTPAT
QKAKLLRQTQGEESQLTGAPTQENQTLHYKLERLQLLMNQRRLRRQTRRYLQTSRPYRHH
QHRL
Download sequence
Identical sequences G3PR25
ENSGACP00000020060 69293.ENSGACP00000020060 ENSGACP00000020060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]