SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020067 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020067
Domain Number 1 Region: 176-286
Classification Level Classification E-value
Superfamily Bromodomain 9.03e-28
Family Bromodomain 0.00043
Further Details:      
 
Domain Number 2 Region: 293-423
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.17e-21
Family PWWP domain 0.008
Further Details:      
 
Domain Number 3 Region: 104-158
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000101
Family PHD domain 0.01
Further Details:      
 
Domain Number 4 Region: 1024-1067
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.0000000279
Family MYND zinc finger 0.0094
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000020067
Domain Number - Region: 925-1026
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.00123
Family Apolipoprotein A-I 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020067   Gene: ENSGACG00000015209   Transcript: ENSGACT00000020106
Sequence length 1089
Comment pep:known_by_projection scaffold:BROADS1:scaffold_68:664340:678826:-1 gene:ENSGACG00000015209 transcript:ENSGACT00000020106 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHPQSLAEEEIKTESDVVEGMDATARAKVADPPGSAERTAAPQKRKASSPTHSSNGHSPS
DTSPSPLKRKKKPGAVNCHSKDQSELRHGPFYYMKQPALTTDPVDVVPQDGRNDFYCWLC
HREGQVLCCELCPRVYHAKCLKLPAEPEGDWFCPECEKITVAECIETQSKAMTMLTIDQL
SYLLKFALQKIKQPGTEPFQKPVSLEQHPDYAEYIFHAMDLSTLEKNIKKKMYGCTEAFL
ADMKWILHNCIIYNGGNHKLTATAKVIVKICEHEMNEIEVCPECYLSSVQKRDNWFCEPC
SPPHPLVWAKLKGFPFWPAKALRDKDGQVDARFFGQHDRAWVPINNCYLMSKEIPFSVKK
TKSIFNSAMQEMEVYVENIRKKFGVFNYAPFRTPFTPNNQLQMLLDPSNPGAGTVKTEKA
DKLRFNFDMTASPKMVLSKTSTPSGMSRRVSMTDMPRSPMSTNSSVHTGSDGEQDMEKPG
RNPAFHYSTGEESMDCTVAITASPVSGKTGPAGNASGSPKPFNPGLVPKQERTAGTGGIL
NLNLDRVKAEMDLKELSETGASASLPTPKRPIRSLDKTIESCKAQLGIDEISEDVYKGVD
HSDSDDSEKSDSSDSEYLSDEEHKPKNSAQDEHDKADRKRPKANTDGEIKEGVTGKAGKA
APEPPLKDKQAAGVPDRGLQDKPTQPPADKPKAQEEGRAAAATAAAAEQDSDSERELVID
LGDEHGGRDSKRARREPGATAAKAVKEPNPAKLEGDKTPKMSTQETEHAVPAALNLVSPA
ASAQPAATSATSGSPGVPSPASTSASATSPLPAAVKKQRPLLPKETAQAVQRAVVWNPTK
FQTSSQKWHMQKVQRQQQQQGPQRPPSQQQNSTSSRYQTRQAAKGTCTPAPSDVNSTSPS
STTAQVTSGGSSSGDVQIPTGSAEVAADIAKYTNKMMETIKGTMTEIYNDLSKSTSGNTI
AEIRRLRIEIEKLQWLHQQELSEMKHNLELTMAEMRQSLEQERERLVAEVKKQTEVEKQQ
LVDETKKKQWCANCRKEAIFYCCWNTSYCDYPCQQAHWPEHMKSCTQSATAPQQEPEGES
NSDPSVKTS
Download sequence
Identical sequences G3PR32
ENSGACP00000020067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]