SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020092 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020092
Domain Number 1 Region: 1714-1829
Classification Level Classification E-value
Superfamily Bromodomain 1.7e-33
Family Bromodomain 0.00021
Further Details:      
 
Domain Number 2 Region: 529-648
Classification Level Classification E-value
Superfamily DNA-binding domain 8.5e-22
Family Methyl-CpG-binding domain, MBD 0.0096
Further Details:      
 
Domain Number 3 Region: 1599-1666
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.95e-18
Family PHD domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020092   Gene: ENSGACG00000015232   Transcript: ENSGACT00000020131
Sequence length 1833
Comment pep:known_by_projection scaffold:BROADS1:scaffold_68:818299:830962:-1 gene:ENSGACG00000015232 transcript:ENSGACT00000020131 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESNNHFNYDTHSSANSGLKLSPGDSLYTNGSSMSFPQQGKNMNGEMNVNGVTTVLGSGG
VPGSHPPSAPYPHMSNHHQGSMGYDYLWGGHPQYGPAMGNPPGHGMHQKQPTVVQPQSQH
HFQAHGQYQLNGGVESSHQAPASGPANMPLTGSQYWNRGNPGPQQMSYNSHSMYGTYPSQ
AHPGITPSQQQQHHQQQQSLQPAPHQPSQQHLHSHRHPHHHHQQHQQPQHYGLMPNGMPY
YQPQPQHPSLPPQANVTTAPISSLQQMVQGSKPPPMTSCFSETSGAPHERSGPPKLTPAS
SMRDRSSSAGVAPPLISALGSPTSTPPMVSCTSSSSVSKTPSAGSRPDDRASSPQRRAAP
AADSGLFPASSSPAAAVNFSSSAAHEGVTIRPLSALPLLTAQASRTAPACAPPALVSLTS
SAGTSSGVVQSSDPAQHPPRAPKRTPAESLAVHPLQPATDPIAPAAGGPQKTPRKPRKPR
TPKAKLIKSPVKGRKRKKPVKVDVNETSDTANDAEENDDDSSTAGNEGACRQRRVATEEQ
VQFPMGHGWKREIRVKKIEDRMKGETWYYTPCGRRMKQFPEIVKYLKKHTDSVVGREHFS
FSPRMPVGDFYEERETAEGKQWILLANEEVPSMIMAITGRRGRPPNPDKEKPRRVRALKA
GQARRPGRPPKPTLMDLLSKVDAKLLKRLEAKEALTEEEKEKLAKIKKKLKRKVSTGAAA
ATAGVTRRAQETRAQEQTDEERIAQGKRVLGARSKAKALAKAQAEAEAAAQAALTAKRAA
ERRAQTQRRLEERKRQQLIAEELKKPIEDMCLTDHKLLPELSRIPGVVLSGKAFAHCLAV
VEFLHGYGKIIGLNIPKDVPSLATLQEGLLGLGDGQGEVQDLLIKLMEAALLDPGLPSFY
QSVKILGDKLVETELTRSTVSEVLRVFLECHGYETDVCNALRTKTFHALPPDTKAAILGF
LVDELNSSNAVTSDIDNTLENMATYRKNKWIIEGKLRKLKAALARRTGRSEEELCFEERR
RSARVAEEETLSLEDGGLVSERGSRRSESPANASIPELERQIDKLSKRQAFFRKKLLQSS
HSMRAILLGQDRYQRRYLALPHLGGVVVEGPEELLTEVPVTFLKKEPKVEEIPTPTTPPP
ALPSSPSSAPSAQTSCPEDNDLPGTASLMSTPRGRGRPRKIKPEVELHLRTAKIRRRRRS
SARSAGGEATPGSPGGGCGPQNLTQVAFQSWLSQSQDAVTNGACSAAGDAPEGNRPEESV
KEAAEKQGQWFNLLPKQPCDEDSLTASQIPSSPPKLLPQTASAAPAIAAPLAQPGRRRRR
GSRGSSPARRGARGAAAKRRGRPPNSVFQELEQLYFTQLVVKPIPASMVRGWWWIKDPEE
LYSTLQALHPRGIREKVLHKHLAKHMESLAEICNKPVNDPIFESKVDEKDLLVEALQQPW
QVQERAMETDVCALQWVEDLEQRVVAADLHLKPYTIPEPDSTRDDLQYYEHDADPRDDWT
VRTKKEWSGLPRVATHPVDLAVLRLSNLERNIERRYLKEPLWNPAEVMRLAPLTPTPGEE
HPMDVFSLESEITSRLRTWRQALDRCRSAPQVCLCLLQLEKAIAWERSVTKVNCQVCRKG
DNDDLLLLCDGCDRGCHMYCLRPKITQVPEGDWFCPTCVAKTRTRVKKRRYEDDSSEDET
SARRSGGGGGGGMATRFKEAVTPPSSARHSGEGSAAKRRRMTTRNQPDLTFCEIILMEME
AHSEAWPFLEPVNPRLVPGYRRVVKNPMDFLTMREKLLQGGYGSCEEFAADAQLVFNNCE
LFNEDTSEVGTAGHSMRRFFESRWAEFYSNKDK
Download sequence
Identical sequences G3PR57
ENSGACP00000020092 69293.ENSGACP00000020092 ENSGACP00000020092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]