SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020104 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGACP00000020104
Domain Number - Region: 426-460
Classification Level Classification E-value
Superfamily UBA-like 0.00803
Family CUE domain 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020104   Gene: ENSGACG00000015245   Transcript: ENSGACT00000020143
Sequence length 462
Comment pep:known_by_projection scaffold:BROADS1:scaffold_68:838515:847050:-1 gene:ENSGACG00000015245 transcript:ENSGACT00000020143 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGEATETVPVIEQEMQQPQVETAGVFNSSAPPEMAIPVSKAIPLEIPPETSVPAEAMGS
PKDASIQSTDDQANGVAATQEKAECTKETRLASTLEPQQKTAEQAGSSANPPGPEEAPPS
AKMPVVSVEGPNAAGSTVEVQGQEPVVVVASAEESAGQEVEQILVEANVHEASAVAAGIL
DDPKAIPTEVLANTKDVKATEAPVTEVEESRNVFVDAAEDKVLPIQMNVNLTTENEDLAK
KEAVTLLPKAVQSKESSKREGPPHSTCHLSGSGTESDSDDSVPDLEEQDSAQTQTQQAQL
AAAAEIDEEPVSKAKQSRSEKKARKAMSKLGLRQVTGVTRVTIRKSKNILFVITKPDVYK
SPASDTYIVFGEAKIEDLSQQAQLAAAEKFKVQGEAVSNIQENTQTPTVQEESEEEEVDE
TGVEVKDIELVMSQANVSRAKAVRALKNNNNDIVNAIMELTM
Download sequence
Identical sequences G3PR69
ENSGACP00000020104 69293.ENSGACP00000020104 ENSGACP00000020104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]