SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020116 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020116
Domain Number 1 Region: 22-114
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000476
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020116   Gene: ENSGACG00000015244   Transcript: ENSGACT00000020155
Sequence length 158
Comment pep:known_by_projection group:BROADS1:groupIII:7325905:7328456:-1 gene:ENSGACG00000015244 transcript:ENSGACT00000020155 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFNEKELASLSRQPSEMAAELGMRGPKKGDVVKRRLVKLVVNFLFYFRTDEEEPIGALL
LEQCRVEREDSRSFSIAFLDEAERKYLFECDSGEQCGEWVDSIIKASYEFMRKNLIFYRT
EIHRLTGKDPLEQYGISDETRFQVNNGLRTRPPCRPQT
Download sequence
Identical sequences G3PR81
ENSGACP00000020116 ENSGACP00000020116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]