SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020124 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020124
Domain Number 1 Region: 290-607
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 7.72e-129
Family Mammalian PLC 0.0000000195
Further Details:      
 
Domain Number 2 Region: 134-289
Classification Level Classification E-value
Superfamily EF-hand 2.07e-42
Family EF-hand modules in multidomain proteins 0.00036
Further Details:      
 
Domain Number 3 Region: 624-751
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.8e-32
Family PLC-like (P variant) 0.00011
Further Details:      
 
Domain Number 4 Region: 11-123
Classification Level Classification E-value
Superfamily PH domain-like 1.61e-26
Family Pleckstrin-homology domain (PH domain) 0.0000932
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020124   Gene: ENSGACG00000015253   Transcript: ENSGACT00000020163
Sequence length 753
Comment pep:known_by_projection group:BROADS1:groupI:26685529:26697862:-1 gene:ENSGACG00000015253 transcript:ENSGACT00000020163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KNVILCPGVQGDDNLQSMLVGSVMRKVKSRTWKKQRYFKLQDDYMTIWYKSKKAGNTHST
FSVSDLEAIRDGHQSEVLLSIADEFPADRCFTLVFRGRRGNLDLVAESADEAQSWINGMR
TLIENLENMGEREKLDQWIGDWFRKADKNNDGRMNFKEVQDLLKMMNVDMNEHHAHRLFT
MADKSQSGMLEDDEFVLFYKMLTQREDVLRVFQAYSVDGQKLLQSDLEDFLREEQLDEID
MQPHAKQLIERYEPSDTAKLLNAMTFDGFLMYLGSAEGSIFNPQWRGVFQDMSQPLCHYF
ISSSHNTYLMEDQLRGQSSVEGYIRALSRGCRCVEVDCWDGANGEPIVYHGHTFTSKILF
KDVVNALENYAFKVSEYPVILSIENHCSVEQQKVMAQHLNHILGDKLLKSTLEGKAPVEL
PSPEDLKGKILLKAKKIGGLEENFNGTVEDPQSGEVSDEDEVAEINEDNLHRESICRRIK
RSTQRLSKELSDCVVYCKSVQFSNFKHSRIHSKFYEVASFTESKARKHLREAGTEFVHHN
SRQLTRVYPSGFRTDSSNFNPQEMWNAGCQIVALNFQTAGEGMDLNDGLFGQNGSCGYVL
KPSFMREVGSRFDPETPQQRDCYQPVILTIQVISGQQLPKVNVKEDSIVDPLVRVEIHGV
PMDQAKQETRYIENNGFNPVWYDTLRFTIHTPELAMVRFVVEDYDKTSKNDFVGQYTLPL
SCVQQGYRHIHLFSKDGTRIPPSSLFVHVRITE
Download sequence
Identical sequences G3PR89
ENSGACP00000020124 ENSGACP00000020124 69293.ENSGACP00000020124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]