SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020132 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020132
Domain Number 1 Region: 665-721
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000000113
Family Tudor domain 0.00024
Further Details:      
 
Domain Number 2 Region: 274-330
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000147
Family UBA domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020132   Gene: ENSGACG00000015264   Transcript: ENSGACT00000020171
Sequence length 763
Comment pep:known_by_projection group:BROADS1:groupII:7115867:7128545:-1 gene:ENSGACG00000015264 transcript:ENSGACT00000020171 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDLTESLTKEGWYLSDEGIAELKGSAEKITHNDIIRIALDSDLRPIGRKIIPSDINSGR
TEKLEGPCVLQVLKVRNVSAPKDHEESQGAPRMLRLQMTDGHTTCVGLEFKHLSKISLNT
PPGTKIKLLGTVQVKNGLLLLDDSKISVLGGEVDHMVEKWELQRSLAKHSRSNIGAEGGP
PPFVPFGQKCARMDDADSRDLDQRKTLQSQTVAKSPDENDDFEKQRTAAIAEVAKTKEAP
RTFGGGGNAGSNLSSGASSFRGRDSYQQRRRDDRVERPESRQDGNYRELVDERALRDIME
MGFNREAARLALMDNNNNLEVALNSLLTGSSGCRPGPEEAECVKPPPRARGRGRGRSRNE
DEEEGAGGRPSGPSTLFDFLESKMGVFSIDEQKSHGPQRHHESKANFSDYYSKDPSHKFS
SHNDHRQQRNDRPPRFHRDLDFPKPGKEPLTDFTTSQTQQWKGQERWSRGTSDRREAKEE
PVLPSSFSSHLIHSKEPQQQMELSAPHHQRSRNGDGGGRNTTWPSNRRGARDTVPTSKGP
DGAAVSEPEGRGNSKRTDRIEEPNNGSRRKGKSDRLNSDQLDRQRDGGPPTFNPRGGRSG
TPQENGVMEHKRTGPIKPTSSQSVPQREPPPKKAPSNNPPPKRRSGQGKGQGPRGPEKSH
SVELAWRPGDQCLALYWEDGKVKFYHARIDAVHPSGSTAVVVFSDYGNCEEVLLHNIKPV
SADVLEEDDGYYDSALEFRPGGDGQPRSTRPTQQYYQPPRARD
Download sequence
Identical sequences G3PR97
ENSGACP00000020132 69293.ENSGACP00000020132 ENSGACP00000020132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]