SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020146 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020146
Domain Number 1 Region: 2-734
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.97e-215
Family Motor proteins 0.00000000727
Further Details:      
 
Domain Number 2 Region: 2035-2153
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000209
Family Second domain of FERM 0.012
Further Details:      
 
Domain Number 3 Region: 1626-1706
Classification Level Classification E-value
Superfamily SH3-domain 0.00000377
Family SH3-domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020146   Gene: ENSGACG00000015269   Transcript: ENSGACT00000020185
Sequence length 2248
Comment pep:novel scaffold:BROADS1:scaffold_48:760666:799826:-1 gene:ENSGACG00000015269 transcript:ENSGACT00000020185 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DEVEDLSQLEEVCESSVLLNLKKRFHRDCIYTYIGNMLLSINPFKPLSIYSEELREKYQG
SEQHRNPPHVYAIADAAFTQSQDSTQEQCIIISGQSGSGKTEASKLIVHYLSSVYQGRND
NLRQPMEVFPILESFGNAKTILNNNSSRFGKYLHIHVLHGVVVGTSLSKYLLEKSRVVFQ
ANEERNYHVFYEMLAGMNEWDKEELYLQGAETYYYLNQGGACELKLKQDKQDFQLLVQCF
ETIGLHADQISTVWAILSSILQLGNICFSSYESESFEVARIFSEAEARRVGSLLQISSEA
LQTVITHRVTETTYDRIYCPLSVESAIEYRDAIAKALYSVLFDWLLEQTNDWLSPTEMDS
TVGIVDIYGFEDLLLINKFKSEEKTLLMHATQCLIKESNKLSSEQKQEEYSAEQIQWYPM
QLKNFHSCLELLSSRPHGILRILDDQTCLPQATDHTFLQKCHYHHCNSPYYAKPKNPLPV
FTVYHYAGAVTYQVHNFLNKNHDQFRTEVVELFARSRLKMVSELFRKVQDAYIQQRELGW
RGKGLRQQPSTAASHFLQSLTELTTRLERCKTTFIHCLKPNYVKHPGIFDVDYVSAQLRH
AGMLETIHIRKEGFPIRMQYSCFIERYGVLLSQKLSQESDREQSVALLAMVDAEEGQYQM
GLTKLFLKELLYQLLEERWSSTQTWAAITIQRNIRGFICRRNFRFFKEKAIVIQSHIRGH
QARKHYKRLRQSFNQFWAVMMITRDTVKRRHWRKECSEVEYEDVGRLEIPAELSARLRSG
AGHQQASGVTEVAPPQVKAGHKLTLPLDVDRYPFSRYAKSILKDTWSQPQGYPLQRSLTP
LEPEDARTALDIYKLILRFTGESELSGWQQQMLGNYIVEKSQSQPALRDEILAQLAYHTW
GRPEEQDSLRGWLLLACCLGAFTPSPTLDKPLLKYVSDNGPREYRSLCQHKLLTSLQLPA
PAARVYPPTQLEWTSNQRRGTMVLDVHTFNDEKLTTEVESWTTGEQLASWLLLFRGVSEA
GHGWSVSLLTDEGWSDLAGSDFVMDLLAETRWGRDYPQEGFCFGPDVISASCQREGSQAG
CVQGERGRPQSFLPAPQGPVAMEEEGMNAMITVQKYTSLSLAGWTSAVVVRGTSSGRGRQ
MDAYVDDLFDPVLDQGPPDMERVAMLNRRMRGGGGIPMYGTGMMMPQTPMPAPPVADPLR
MAASQQALINQQALLMAQQMTMQAMNLSERRSVNRSPSPLSASPSPPPARTKAPAAKRTS
SYKPPKPEVIVNIDPQQERSPPSPPKSPPQTATKPPVKSLHTPPARVEEPPPAALTTPTS
STSTPTKNTPEPTSKIREIIKMYNSRPQQEAKPFEPVRPAPRHFIKKNDPKEEALAKLKN
MSPAQQQKFQGIPDPPPMAAPSLGECGPLCVQPNVNVMQDEDGIPSQLHRFSAGVYFSYS
KMPGKLFLRKEVFYPKEMFDRPYILNLLCEQIMRDTYSDSCVRISKEERRKMKDLLDFSV
GMTISTIQNEVMKKRIVIAARDNWENYFIRLFPVKLKSFSGDSELLGVSHRGIRLLKMVG
ASGINPKHLRLLTYYSFSELLSVDLQGADKVKLELTRETLVMQSSRAPQITAMIRLFLQE
LLRDSGHVVALTSYVTDDKSLLSFSKGDVIKLLPMEGLQTGEMPAGFRFQICSLFRMSCS
VFPLGWRFGTMGGRSGLFPCDLTQPSAAPDYHSLHLARRDVRRKSTRGARPAGGRVGSVD
SELLGQEASVSIQGSQPENSSGMAEFAMKYFRSLFRVGNTGLPESGRNFAEAVQHTEVPI
RESLILYNDPEINSLSVGCFFNVMQFMGDMPMTRNNTQTDCLSHILLLGKEKELLRDEIY
CQIIKQTTNNPTKSICTLGWRLFNLITGFFPCSDTLQPFVSHHLRDISQDYEHPYQELAS
VCQDNLQRSLSFGGRRNVPSSVEMEAILAGKTSRRIPVQLPGGVDFPIRIRSFSMAVEVL
TEFCKEMSITNPTEIREFSILANENQGEMLRPLQAEEYLFDFLLDDGSVFFSLRRLMWRS
PLSYNSDLYVEFHYQQLLVDYLSGRLMVAPAARGPSSVQQIAELSALQHLARGLRDQPSL
PEMKEYLPPQDGLSSNAEEIHSFCLGQIAAMHSLSPQDAKIQFIEMLCTMPQFGSNSFLA
QKVSQRGCPSPCMVTIGQEGVLFLHPKTQERAFLIPLADVRSMRTVRPKKQGKAPSVEIH
YSQGRAKKLTVHLKQAKEFCHILALMME
Download sequence
Identical sequences G3PRB1
ENSGACP00000020146 ENSGACP00000020146 69293.ENSGACP00000020146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]