SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020164 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020164
Domain Number 1 Region: 285-590
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.02e-124
Family Mammalian PLC 0.0000000388
Further Details:      
 
Domain Number 2 Region: 130-284
Classification Level Classification E-value
Superfamily EF-hand 1.31e-40
Family EF-hand modules in multidomain proteins 0.00064
Further Details:      
 
Domain Number 3 Region: 611-732
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.31e-29
Family PLC-like (P variant) 0.0001
Further Details:      
 
Domain Number 4 Region: 6-119
Classification Level Classification E-value
Superfamily PH domain-like 1.14e-22
Family Pleckstrin-homology domain (PH domain) 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020164   Gene: ENSGACG00000015291   Transcript: ENSGACT00000020203
Sequence length 735
Comment pep:known_by_projection scaffold:BROADS1:scaffold_48:844428:853520:-1 gene:ENSGACG00000015291 transcript:ENSGACT00000020203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGVQEDEDVKRMLQGSSMIKVRSPRWQKRRTLKLMGDGVTVWCQSHKTSNWAKEQQSFSV
MEVECVREGCQSETLRQLVGSVPEQRCLTVVFKGPRKSLNLLCQSQEEAHHWARGIRTLQ
ERVDNMTQKEKLDHWIHSFLSRADQNQDDKMSYDEVQTLLQMINIDLSDQYARSLFQKCD
QSADGRLDHGEIEVFCRELLRRPELDTVFTRYSANGCVLSTVDLRDFLKDQGEDASLIHA
QSLILTYELNDWAQKNQLMTRNGFTMYMLSKENTAFNPEHARVYQDMKRPLAHYFISSSH
NTYLTKDQLTGDSSTEPYIRALNHGCRCVELDCWDGDKGEPVLYHGHTFTSKVPFVKVIE
TINDYAFKASPYPLILSLENHCSVEQQAVMARHLRSILGDKLLTEPLGGLDPHNLPSPED
LKGKILVKGKKEGTAEKPSSSSSDLSSSDEEAGGAEGQTGRRPEDETLSPELSALVVYTR
SVPFKGFEQAAKSPATNMSSFSESEALRHAKDSGPGTYFVRHNSHQLSRVYPSGQRLQSS
NYNPQEMWNAGCQIVALNFQTHGEQMDLNNGRFLQNGQCGYALKPPFMCEPHTTFNPENC
PDRAVVSSFFQVISAQQLPKPEWDKPTSIVDPQVWVEIHGVPIDNNKKRTPHVDNNGFNP
RWDCTFNFTVHVPDLALVRFMVEDHDYTSSNDFLGQCTLPLTSLRTGYRHVRLLKLDGSR
LSPSSLFIHLKVTQC
Download sequence
Identical sequences G3PRC9
ENSGACP00000020164 69293.ENSGACP00000020164 ENSGACP00000020164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]