SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020179 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020179
Domain Number 1 Region: 671-810
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.8e-32
Family Synaptotagmin-like (S variant) 0.047
Further Details:      
 
Domain Number 2 Region: 13-147
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.51e-24
Family PLC-like (P variant) 0.000000907
Further Details:      
 
Domain Number 3 Region: 1532-1652
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.64e-18
Family Synaptotagmin-like (S variant) 0.015
Further Details:      
 
Domain Number 4 Region: 537-596
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000138
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020179   Gene: ENSGACG00000015301   Transcript: ENSGACT00000020218
Sequence length 1691
Comment pep:known_by_projection group:BROADS1:groupIII:7469371:7488754:-1 gene:ENSGACG00000015301 transcript:ENSGACT00000020218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSLCVSTVKKAKLDGPQEKFNTYVTLKVQNVKSTTIAVRGNLPSWEQDFMFEINRLDLGL
TVEMWNKGLIWDTMVGTLWIPLHNIRQSNEEGPGEWLTLDSQVIMTDNEISGTKEPTLHL
VLLDTRFELPLDIPEDEARYWAKKLEQLNAMRDQDTLSLQEEQERPLRVPGTQCCNWSLW
GDQQNEDPDSAVDDRDSDYRSETSNSIPPPYYSTSQPNASVHQYPISQQHRSSRSLSFPR
SGVSHDLDYQPQRTVSPSGSYASSAELSRGSSQLSEEDYVVEYGERDPYDENDSYHSCHS
SVSYSKGSPDWDPDETQGAYSDEGGYSKDGGEEAALYEEDDGALYEGEEGGLYEDEEIMY
DEDDLYNLDGTLSEDMEPPFTPTPTSTAPTTLDVPSSRPPLEKQSSLHQQQPASQPTNQT
SNQSRVVEEPKEPVDPAVRAKENWLRLYNKVLEQLREARGETSSSLWFGKGGVGGALYSI
DSMPDLRKRKAVPLVRDLAMSLVQSSRKAGITSAMASTTLGNEELKSHVYKKTLQALIYP
ISSTTPHNFEVWTATTPTYCYECEGLLWGIARQGMRCSECGVKCHDKCQDLLNADCLQRA
AEKSSKHGAEDRTQGIIMVLKDRMKIRERNKPEIFELILEVFALDKTTHGTQMKQIKQSV
LDGTSKWSAKISITVVCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIYGNLNPVWEENF
HFECHNSSDRIKVRVWDEDDDIKSRVKQRFKRESDDFLGQTIIEVRTLSGEMDVWYNLDK
RTDKSAVSGAIRMHISVEIKGEETVAPYHVQYTCLHEHLFQYTTEEQNGGVVKIPDAKGD
DAWKVYFEETAQEIVDEFAMRYGVESIYQAMTHFACLSSKYMCPGVPAVMSTLLANINAY
YAHTTQSSNNVSASDRFAASNFGKERFVKLLDQLHNSLRIDLSMYRNNFPASSPERLQDL
KSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHDLYNREYQTD
PSKAVPPDEQGPNTKNLDFWSKLITLIVSIIEEDKNSYTPCLNQFPQELNVGKISAEVMW
NMFAQDMRYAMEEHEKNRLCKSADYMNLHFKVKWLYNEYCKELSTFQKHVPEYPAWFEPF
VVMWLDENEEVSRDFLHGALERDKKDGFQVTSEHALFSCSVVDVFSQLNQSFEIIRKLEC
PDPQIVGNYMKRFAKTIGNVLLSYADIIAKDFPNHVKKEKVPCIIINNIQQLRVQLEKMF
EAMGGKNLNLEASDFLKELQNKLNSVMDDLSRIFAVSFQPQIEDNVRQMGDILAQVKGQT
VPANGSVVQEADNVLQPIMDFLDSNLSLFAKICEKTVLKRVLKELWKLVMNTMEKTIVLP
TLTDQTVIVKSLGMKKGYSNRILNTTLCSHSSGTQMIFNAAKELGQLSKLKEHMGREEAK
ALSPKQCAVIELALDTIKQYFHAGGVGLKKTFLEKSPDLQSLRYALSLYTQATDKLIRKF
VLSQNAQASGVDAVGEVVMCVDILPQPNGEHKISIKVVAANDLKWKAQGFRPFVEVYIIG
PHLSDKKRKFATKSKNNTWSPKFNEGFQYSLGTEVGPESYELQVCVKDYCFAREDRTVGM
SVVQVKDIASKGSATLWMPLGRRVHMDETGLTVLRILSQRNNDDVAKEFVKLKSDQRSAE
EGRSMLRPPAP
Download sequence
Identical sequences G3PRE4
69293.ENSGACP00000020179 ENSGACP00000020179 ENSGACP00000020179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]