SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020182 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020182
Domain Number 1 Region: 498-692
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.47e-56
Family BCR-homology GTPase activation domain (BH-domain) 0.0000607
Further Details:      
 
Domain Number 2 Region: 296-416
Classification Level Classification E-value
Superfamily PH domain-like 6.43e-29
Family Pleckstrin-homology domain (PH domain) 0.0000282
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020182   Gene: ENSGACG00000015304   Transcript: ENSGACT00000020221
Sequence length 737
Comment pep:known_by_projection scaffold:BROADS1:scaffold_48:868780:878697:-1 gene:ENSGACG00000015304 transcript:ENSGACT00000020221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EEGELVGYKSYSPSFSHKAGHLLQQAHSFREPGYSGPHLDWSPDSRGGSVDGELAAVPRA
QSTPAPSASMEERARPGEDAELVSPGSLSQEVVLRQKPPSGRRTPVQAARLTHYAGNVES
PESPGVEPTQGTPSPAGGPGTNRRANGSLAQHAYNSLASIPFIDEPSGPSSDLQACYVPA
RSVVSSSQASTTLTSTSVPPTISSISPFVRLGSQDCSSIKSRRSSYLLAITTERSKSCDE
GLNTFREEGRVFSKLPKRVKSFFADGSLESLRVQEEARSKRHSTSELGTITFSDVRTEGW
LHYKQILTEKGKKVGGGMRPWKRVFSVLRSHSLFLYKDKREAVLHGAGAGPSLDEHPPIS
IRGCLIDIAYSETKRKHTLRLTTQDFCEYLLQAEDRDDMLAWIRVIRENSKTDNEEIGFS
RQALINKKLNDYRKHSHSLTGSKPDSSPKAHRMMPPFLLAKTDNTSVNRASRTGTEDNKA
LWGINLMKKAKKTSSPKAFGVRLEDCQPAVNHKFVPLIVEMCCGVVEETGLDYTGIYRVP
GNNAMVSNLQEHLNKGMDINTAEERWQDLNVISSLLKSFFRKLPEPLFTDDKYNDFIDAN
RIEDAEDRLKTMKKLLHDLPDHYHHTLKFLVGHLKKVADHCELNKMEPRNLALVFGPTLV
RTSEDNMTDMVTHMPDRYKIVETLILHHDWFFTTGELDEEEKAPEDKRDMQPVPNIDHLL
SNIGRPGMPGEASEISV
Download sequence
Identical sequences G3PRE7
ENSGACP00000020182 69293.ENSGACP00000020182 ENSGACP00000020182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]